DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and PIRL6

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_179523.1 Gene:PIRL6 / 816450 AraportID:AT2G19330 Length:380 Species:Arabidopsis thaliana


Alignment Length:334 Identity:93/334 - (27%)
Similarity:141/334 - (42%) Gaps:62/334 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ASHSGPHPLPVEVTAAEEEQAATFGQ--------------TSPQKLSLKGSQLGGSILIGNYNYL 70
            |.|..|.        .::||..|..|              :||...|...|....|.   |.|. 
plant     6 AYHQQPQ--------IQKEQMMTMDQRNNHQRKRSPLSSPSSPSSPSSPSSPKSPSF---NNNE- 58

  Fly    71 TQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVPLK 135
                  |..:||::||.:| ||:|.   |..:.|    ..:..|...:|:|..|..:.|..: |.
plant    59 ------EERLEVVNLSGMA-LESLP---NPSLNL----AQICKLDLSNNHLQTIPESLTARL-LN 108

  Fly   136 LQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQL-DQ 199
            |..:|:..|....|||.:|..:.|..:|.|.|.|.:....:::.|  .|..|:..:|.|.:| |.
plant   109 LIALDVHSNQIKALPNSIGCLSKLKTLNVSGNFLVSFPKSIQHCR--SLEELNANFNKLIRLPDS 171

  Fly   200 FPEGFSSIRSLQLQSNELPSLPDNFFAVTH-ARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAG 263
            .....:::|.|.:.||:|.|||   .::|| ..|..|:...|.|..||...:|    |:||.:..
plant   172 IGFELTNLRKLSINSNKLISLP---ISITHLTSLRVLDARLNCLMILPDDLEN----LINLEILN 229

  Fly   264 NHLNDSIFEPLHNAAKLRV----LHLAYNRIGVLPAA--CVRNWPELEILVLSGNMLQQLPEEVA 322
            ...|......|.::..|.:    |.::||:|.|||.:  |:|   .|..|.:.||.|...|.||.
plant   230 VSQNFQYLSALPSSIGLLMNLIELDVSYNKITVLPESIGCMR---RLRKLSVEGNPLVSPPIEVM 291

  Fly   323 TLGQLRVLR 331
            . ..|:|:|
plant   292 E-QNLQVVR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/18 (28%)
LRR_8 109..169 CDD:290566 17/59 (29%)
leucine-rich repeat 111..135 CDD:275380 5/23 (22%)
leucine-rich repeat 136..158 CDD:275380 7/21 (33%)
leucine-rich repeat 159..183 CDD:275380 6/23 (26%)
leucine-rich repeat 184..209 CDD:275380 6/25 (24%)
LRR_8 205..266 CDD:290566 20/61 (33%)
leucine-rich repeat 210..230 CDD:275380 9/20 (45%)
leucine-rich repeat 232..255 CDD:275380 7/22 (32%)
LRR_RI <256..410 CDD:238064 26/82 (32%)
leucine-rich repeat 256..276 CDD:275380 5/19 (26%)
LRR_8 279..359 CDD:290566 21/59 (36%)
leucine-rich repeat 280..303 CDD:275380 10/28 (36%)
leucine-rich repeat 304..348 CDD:275380 11/28 (39%)
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
PIRL6NP_179523.1 PRK15370 <55..>307 CDD:185268 81/274 (30%)
leucine-rich repeat 62..84 CDD:275380 10/29 (34%)
leucine-rich repeat 85..108 CDD:275380 5/23 (22%)
leucine-rich repeat 109..131 CDD:275380 7/21 (33%)
leucine-rich repeat 132..154 CDD:275380 6/23 (26%)
leucine-rich repeat 155..178 CDD:275380 6/22 (27%)
leucine-rich repeat 179..201 CDD:275380 10/24 (42%)
leucine-rich repeat 202..224 CDD:275380 8/25 (32%)
leucine-rich repeat 225..249 CDD:275380 4/23 (17%)
leucine-rich repeat 250..272 CDD:275380 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45752
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.