DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Adcy2

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_112269.2 Gene:Adcy2 / 81636 RGDID:619965 Length:1095 Species:Rattus norvegicus


Alignment Length:204 Identity:45/204 - (22%)
Similarity:77/204 - (37%) Gaps:72/204 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAA 278
            ||...|:|||..::.|||         .|..||.:   .::.::.|      ::.|:|..::...
  Rat   719 SNANVSVPDNQASILHAR---------NLFFLPYF---IYSCILGL------ISCSVFLRVNYEL 765

  Fly   279 KLRVLHLA---YNRIGVLPAACVRN------------WPELE-------------ILVLS----- 310
            |:.::.:|   ||.|.:...|.|.:            |.:|:             :|||.     
  Rat   766 KMLIMMVALVGYNTILLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFFITLLVLGRQSEY 830

  Fly   311 --------GNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLA------MLKVLDLSHNHLDR 361
                    .|..::..||:.|:..|      |.:||.....|.:|      .||..:|.|...|.
  Rat   831 YCRLDFLWKNKFKKEREEIETMENL------NRVLLENVLPAHVAEHFLARSLKNEELYHQSYDC 889

  Fly   362 VNLL-ALVP 369
            |.:: |.:|
  Rat   890 VCVMFASIP 898

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566 13/51 (25%)
leucine-rich repeat 210..230 CDD:275380 6/15 (40%)
leucine-rich repeat 232..255 CDD:275380 3/22 (14%)
LRR_RI <256..410 CDD:238064 33/162 (20%)
leucine-rich repeat 256..276 CDD:275380 3/19 (16%)
LRR_8 279..359 CDD:290566 26/126 (21%)
leucine-rich repeat 280..303 CDD:275380 7/37 (19%)
leucine-rich repeat 304..348 CDD:275380 14/75 (19%)
leucine-rich repeat 349..372 CDD:275380 8/22 (36%)
PP2Cc 461..655 CDD:294085
Adcy2NP_112269.2 AC_N <37..264 CDD:318454
Guanylate_cyc 285..469 CDD:306677
DUF1053 499..603 CDD:399378
Guanylate_cyc 882..1081 CDD:306677 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.