DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and LRRC2

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_078788.2 Gene:LRRC2 / 79442 HGNCID:14676 Length:371 Species:Homo sapiens


Alignment Length:261 Identity:73/261 - (27%)
Similarity:111/261 - (42%) Gaps:64/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 NFFAVTHARL------ETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNH---LNDSIFEPLH--- 275
            |.|..|..||      .||    .:.|:||:......:|.| ..|:|.|   |.||:.|..|   
Human    66 NGFIDTSVRLLDKIERNTL----TRQSSLPKDRGKRSSAFV-FELSGEHWTELPDSLKEQTHLRE 125

  Fly   276 ----NA------------AKLRVLHLAYNRIGVLPA--ACVRNWPELEILVLSGNMLQQLPEEVA 322
                |.            ..:|:|.|..|:|..|||  .|::|..||.:   ..|.|:.:|.|:.
Human   126 WYISNTLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGCLKNLKELNV---GFNYLKSIPPELG 187

  Fly   323 TLGQLRVLRCCNNL-LLCTP-QLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGN---- 381
            ....|..|.|..|| |:..| :|:.|..:..:|:|.|....|.:..|..| ||::||:|.|    
Human   188 DCENLERLDCSGNLELMELPFELSNLKQVTFVDISANKFSSVPICVLRMS-NLQWLDISSNNLTD 251

  Fly   382 LQLQVDE----QQFKVCQSQ---------SQRHWSLVDVSGNNRAALPT------TKIRQVSAQR 427
            |...:|.    |.|.:.:::         :.:..:|:.|||::...|||      |.::.||...
Human   252 LPQDIDRLEELQSFLLYKNKLTYLPYSMLNLKKLTLLVVSGDHLVELPTALCDSSTPLKFVSLMD 316

  Fly   428 N 428
            |
Human   317 N 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566 15/51 (29%)
leucine-rich repeat 210..230 CDD:275380 3/6 (50%)
leucine-rich repeat 232..255 CDD:275380 6/28 (21%)
LRR_RI <256..410 CDD:238064 54/196 (28%)
leucine-rich repeat 256..276 CDD:275380 9/29 (31%)
LRR_8 279..359 CDD:290566 28/83 (34%)
leucine-rich repeat 280..303 CDD:275380 10/24 (42%)
leucine-rich repeat 304..348 CDD:275380 14/45 (31%)
leucine-rich repeat 349..372 CDD:275380 6/22 (27%)
PP2Cc 461..655 CDD:294085
LRRC2NP_078788.2 LRR 1 122..143 2/20 (10%)
leucine-rich repeat 123..145 CDD:275380 1/21 (5%)
LRR 2 145..166 8/20 (40%)
leucine-rich repeat 146..168 CDD:275380 9/21 (43%)
LRR_8 147..201 CDD:290566 19/56 (34%)
LRR_4 167..>201 CDD:289563 10/36 (28%)
LRR 3 168..189 7/23 (30%)
leucine-rich repeat 169..191 CDD:275380 6/24 (25%)
LRR 4 191..214 8/22 (36%)
leucine-rich repeat 192..215 CDD:275380 9/22 (41%)
LRR 5 215..235 4/19 (21%)
leucine-rich repeat 216..238 CDD:275380 6/22 (27%)
LRR_8 237..295 CDD:290566 15/58 (26%)
LRR 6 238..260 8/21 (38%)
leucine-rich repeat 239..261 CDD:275380 7/21 (33%)
LRR 7 261..283 2/21 (10%)
leucine-rich repeat 262..284 CDD:275380 2/21 (10%)
LRR 8 284..305 7/20 (35%)
leucine-rich repeat 285..308 CDD:275380 7/22 (32%)
LRR 9 308..329 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45752
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.