| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006512427.1 | Gene: | Lrrc2 / 74249 | MGIID: | 1921499 | Length: | 379 | Species: | Mus musculus |
| Alignment Length: | 300 | Identity: | 77/300 - (25%) |
|---|---|---|---|
| Similarity: | 126/300 - (42%) | Gaps: | 57/300 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 140 DISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGF 204
Fly 205 SSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGN-HLND 268
Fly 269 SIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCC 333
Fly 334 NNLLLCTPQ-LAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQS- 396
Fly 397 ----QSQR---HWS-------LVDVSGNNRAALP--TTKI 420 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
| LRR_8 | 109..169 | CDD:290566 | 4/28 (14%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | |||
| leucine-rich repeat | 136..158 | CDD:275380 | 4/17 (24%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 3/23 (13%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 4/24 (17%) | ||
| LRR_8 | 205..266 | CDD:290566 | 18/61 (30%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 5/19 (26%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 9/22 (41%) | ||
| LRR_RI | <256..410 | CDD:238064 | 46/170 (27%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 9/20 (45%) | ||
| LRR_8 | 279..359 | CDD:290566 | 21/80 (26%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | 14/44 (32%) | ||
| leucine-rich repeat | 349..372 | CDD:275380 | 7/22 (32%) | ||
| PP2Cc | 461..655 | CDD:294085 | |||
| Lrrc2 | XP_006512427.1 | LRR | <107..376 | CDD:227223 | 77/299 (26%) |
| leucine-rich repeat | 131..153 | CDD:275380 | 6/30 (20%) | ||
| leucine-rich repeat | 154..176 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 177..199 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 200..223 | CDD:275380 | 10/23 (43%) | ||
| leucine-rich repeat | 224..245 | CDD:275380 | 4/21 (19%) | ||
| leucine-rich repeat | 247..269 | CDD:275380 | 8/21 (38%) | ||
| leucine-rich repeat | 270..292 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 293..316 | CDD:275380 | 7/22 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45752 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||