DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and TPBG

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001159864.1 Gene:TPBG / 7162 HGNCID:12004 Length:420 Species:Homo sapiens


Alignment Length:323 Identity:80/323 - (24%)
Similarity:115/323 - (35%) Gaps:92/323 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELP 218
            |.|:...|......||..:|::|..:     ||.....:............:|..|.|      |
Human     3 GGCSRGPAAGDGRLRLARLALVLLGW-----VSSSSPTSSASSFSSSAPFLASAVSAQ------P 56

  Fly   219 SLPDNFFAVTHARLETLNVSC-NKLST-----LPRYEQNNHAALVNLSLAGNH---LNDSIFEPL 274
            .|||...|:.........|.| |:..|     ||.|.:       ||.|.||.   |....|...
Human    57 PLPDQCPALCECSEAARTVKCVNRNLTEVPTDLPAYVR-------NLFLTGNQLAVLPAGAFARR 114

  Fly   275 HNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQL---------------------- 317
            ...|:|..|:|:.:|:..:.|....:.|.|..|.||.|.|..|                      
Human   115 PPLAELAALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELI 179

  Fly   318 ------PEE-----------VATL--GQ----LRVLRCCNNLLLCTPQ--LAKLAMLKVLDLSHN 357
                  ||:           ||.|  |:    ||.|...:|..|..|:  ||:|..|:.||||:|
Human   180 LNHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLDLSNN 244

  Fly   358 HLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKI 420
            .|..   |..|..|||.:|:     .|.:::...||.     .:.:|.::.|     ||..::
Human   245 SLVS---LTYVSFRNLTHLE-----SLHLEDNALKVL-----HNGTLAELQG-----LPHIRV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 3/14 (21%)
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380 2/3 (67%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 3/24 (13%)
LRR_8 205..266 CDD:290566 20/69 (29%)
leucine-rich repeat 210..230 CDD:275380 6/19 (32%)
leucine-rich repeat 232..255 CDD:275380 7/28 (25%)
LRR_RI <256..410 CDD:238064 53/203 (26%)
leucine-rich repeat 256..276 CDD:275380 7/22 (32%)
LRR_8 279..359 CDD:290566 34/126 (27%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 304..348 CDD:275380 22/90 (24%)
leucine-rich repeat 349..372 CDD:275380 9/22 (41%)
PP2Cc 461..655 CDD:294085
TPBGNP_001159864.1 LRRNT 61..95 CDD:214470 8/40 (20%)
leucine-rich repeat 73..95 CDD:275380 7/28 (25%)
LRR 1. /evidence=ECO:0000269|PubMed:24582434 92..113 8/27 (30%)
LRR_8 93..154 CDD:338972 19/67 (28%)
leucine-rich repeat 96..119 CDD:275380 6/22 (27%)
LRR 2. /evidence=ECO:0000269|PubMed:24582434 116..139 6/22 (27%)
leucine-rich repeat 120..143 CDD:275380 5/22 (23%)
LRR 3. /evidence=ECO:0000269|PubMed:24582434 141..163 8/21 (38%)
leucine-rich repeat 144..167 CDD:275380 7/22 (32%)
LRR 4. /evidence=ECO:0000269|PubMed:24582434 172..204 4/31 (13%)
leucine-rich repeat 175..211 CDD:275380 6/35 (17%)
LRR 5. /evidence=ECO:0000269|PubMed:24582434 209..232 7/22 (32%)
LRR_8 211..270 CDD:338972 23/66 (35%)
leucine-rich repeat 212..235 CDD:275380 9/22 (41%)
LRR 6. /evidence=ECO:0000269|PubMed:24582434 233..255 10/24 (42%)
leucine-rich repeat 236..259 CDD:275380 12/25 (48%)
LRR 7. /evidence=ECO:0000269|PubMed:24582434 256..275 6/28 (21%)
leucine-rich repeat 260..283 CDD:275380 5/32 (16%)
LRRCT 294..345 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.