DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Lrrc39

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001103107.1 Gene:Lrrc39 / 691307 RGDID:1585106 Length:334 Species:Rattus norvegicus


Alignment Length:214 Identity:62/214 - (28%)
Similarity:101/214 - (47%) Gaps:17/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 RITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLST 244
            ::.:|....|....|.::.:|...|..:..|.|..|.:..:|.....:|  ||:.|.:|.||:.|
  Rat    81 KLNQLQEWQLHRTGLLKIPEFIGRFQHLIVLDLSRNTISEIPRGIGLLT--RLQELILSYNKIKT 143

  Fly   245 LPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVL 309
            :|: |.:|.|:|..|.||.|.....:...|....||..|.|:.|:...:|.| |.:.|.||.|.:
  Rat   144 VPK-ELSNCASLEKLELAVNRDISDLPTELSKLLKLTHLDLSMNQFTTIPLA-VLDMPALEWLDM 206

  Fly   310 SGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQ-LAKLAMLKVLDLSHNHLDRVNLLALVPS--- 370
            ..|.|||||:.:..:..|..|....|.:.|.|: :..:..|..|.||:|.|..      :|.   
  Rat   207 GSNSLQQLPDTLDRMQSLHTLWLQRNEITCLPETIRNMKNLGTLVLSNNKLQD------IPGCME 265

  Fly   371 --RNLKYLDLSGN-LQLQV 386
              .:|::::...| |:|:|
  Rat   266 EMTSLRFVNFRDNPLRLEV 284

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380 0/2 (0%)
leucine-rich repeat 184..209 CDD:275380 5/24 (21%)
LRR_8 205..266 CDD:290566 21/60 (35%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 9/22 (41%)
LRR_RI <256..410 CDD:238064 41/138 (30%)
leucine-rich repeat 256..276 CDD:275380 6/19 (32%)
LRR_8 279..359 CDD:290566 28/80 (35%)
leucine-rich repeat 280..303 CDD:275380 7/22 (32%)
leucine-rich repeat 304..348 CDD:275380 14/44 (32%)
leucine-rich repeat 349..372 CDD:275380 7/27 (26%)
PP2Cc 461..655 CDD:294085
Lrrc39NP_001103107.1 LRR 41..>286 CDD:227223 62/214 (29%)