DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and LRFN1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_065913.1 Gene:LRFN1 / 57622 HGNCID:29290 Length:771 Species:Homo sapiens


Alignment Length:762 Identity:154/762 - (20%)
Similarity:247/762 - (32%) Gaps:229/762 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 RLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPA 295
            |:..|.::.|.::.:.|.:..|..:||:|:|:.|.:.........:...||.|||..||:..:..
Human    66 RVVELRLTDNFIAAVRRRDFANMTSLVHLTLSRNTIGQVAAGAFADLRALRALHLDSNRLAEVRG 130

  Fly   296 ACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLD 360
            ..:|....|..|:|..|.::::  |.|...                  |.|:.::.||||:|:|:
Human   131 DQLRGLGNLRHLILGNNQIRRV--ESAAFD------------------AFLSTVEDLDLSYNNLE 175

  Fly   361 RVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLV--DVSGNNRAALPTTKIRQV 423
            .:...|:....||..|.|..||...:.|..|      .|.| .||  |::.|....||...: .:
Human   176 ALPWEAVGQMVNLNTLTLDHNLIDHIAEGTF------VQLH-KLVRLDMTSNRLHKLPPDGL-FL 232

  Fly   424 SAQRNQNKTSGPWTMGFAETPGSGDCRKLSVYQL------------------------------- 457
            .:|....|...|.|:.|...|...:|..|.:.:|                               
Human   233 RSQGTGPKPPTPLTVSFGGNPLHCNCELLWLRRLTREDDLETCATPEHLTDRYFWSIPEEEFLCE 297

  Fly   458 -----RAANYGGSDEALYGMFEALEGRGRAAQEMSHLVPDLMKQEQMVKDSA------------- 504
                 |.|  ||  .||....:|:..|.||..:...:|..:....:::.:|:             
Human   298 PPLITRQA--GG--RALVVEGQAVSLRCRAVGDPEPVVHWVAPDGRLLGNSSRTRVRGDGTLDVT 358

  Fly   505 ---VRDYMKFTLLAAQ---------QQCGSVRSAALFHLTRTRAPSKVRPLKSKRYVLRMASTGG 557
               :||...||.:|:.         :.|  |....|........|....|..|.  :......|.
Human   359 ITTLRDSGTFTCIASNAAGEATAPVEVC--VVPLPLMAPPPAAPPPLTEPGSSD--IATPGRPGA 419

  Fly   558 LDAYLIRRTSQLRLTKPDVI---------------QKDQIHSMPDPHVLELILSNDDEYLV---- 603
            .|:...||.....||...|:               |.....|:.|..|..:|.|....:||    
Human   420 NDSAAERRLVAAELTSNSVLIRWPAQRPVPGIRMYQVQYNSSVDDSLVYRMIPSTSQTFLVNDLA 484

  Fly   604 VGNAQLWSVMDIDRAAREIRKEENSLLAAKRLVDIAQSFAAAES--------------------- 647
            .|.|       .|.....:..:..:.|.|.|:|...|...|.:.                     
Human   485 AGRA-------YDLCVLAVYDDGATALPATRVVGCVQFTTAGDPAPCRPLRAHFLGGTMIIAIGG 542

  Fly   648 ---------LSVIVVRFRHLGTDVDHLIRELKQSVRKKPQPVSLPLSSGSVCKRTCCDRSNACRH 703
                     :.::::|::..| |.|.  |.:|.|       .|||..| .||.:|     |.   
Human   543 VIVASVLVFIVLLMIRYKVYG-DGDS--RRVKGS-------RSLPRVS-HVCSQT-----NG--- 588

  Fly   704 RAIEQEPLAGRSSPSGQSDRDLLAKDKDDEFVLAHARVLQEEQQLEMLDETESVSESVLSEEQFK 768
                    ||..:                    |.|..|..:...|.|.|.||.:...::.|...
Human   589 --------AGTGA--------------------AQAPALPAQDHYEALREVESQAAPAVAVEAKA 625

  Fly   769 CWEYMLEQNTQLLFDKELNTISKSFTKQRTVPNAIMA-----ATVLPERNDFTSNLMRTVTNKFI 828
            ..........:::..:.|   ..|.|....:|:...:     |.|.|.|:  .|..:..      
Human   626 MEAETASAEPEVVLGRSL---GGSATSLCLLPSEETSGEESRAAVGPRRS--RSGALEP------ 679

  Fly   829 STSTPQLPQPITTSVPLGS----YHQVKQAPPGHFGSALSFQQAHSY 871
            .||.|    |....||.|:    ..|.:.:..|.:|:..   |:|||
Human   680 PTSAP----PTLALVPGGAAARPRPQQRYSFDGDYGALF---QSHSY 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566 10/34 (29%)
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380 4/22 (18%)
LRR_RI <256..410 CDD:238064 41/155 (26%)
leucine-rich repeat 256..276 CDD:275380 5/19 (26%)
LRR_8 279..359 CDD:290566 21/79 (27%)
leucine-rich repeat 280..303 CDD:275380 8/22 (36%)
leucine-rich repeat 304..348 CDD:275380 8/43 (19%)
leucine-rich repeat 349..372 CDD:275380 7/22 (32%)
PP2Cc 461..655 CDD:294085 45/267 (17%)
LRFN1NP_065913.1 LRR_RI <65..174 CDD:238064 31/127 (24%)
LRR_8 65..125 CDD:290566 16/58 (28%)
LRR 1 66..87 4/20 (20%)
leucine-rich repeat 67..90 CDD:275380 4/22 (18%)
LRR 2 90..111 5/20 (25%)
leucine-rich repeat 91..114 CDD:275380 5/22 (23%)
LRR_8 113..174 CDD:290566 21/80 (26%)
LRR 3 114..135 7/20 (35%)
leucine-rich repeat 115..138 CDD:275380 8/22 (36%)
LRR 4 138..159 6/40 (15%)
leucine-rich repeat 139..163 CDD:275380 8/43 (19%)
LRR_8 162..222 CDD:290566 21/66 (32%)
LRR 5 163..184 7/20 (35%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
LRR_4 165..203 CDD:289563 13/37 (35%)
LRR 6 187..208 8/26 (31%)
leucine-rich repeat 188..211 CDD:275380 9/29 (31%)
LRR 7 211..232 6/21 (29%)
leucine-rich repeat 212..230 CDD:275380 6/17 (35%)
LRRCT 252..>284 CDD:214507 4/31 (13%)
IG_like 310..385 CDD:214653 12/74 (16%)
Ig 314..387 CDD:299845 12/74 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..422 4/26 (15%)
fn3 426..500 CDD:278470 16/80 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..743 20/81 (25%)
PDZ-binding 768..771
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.