DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and LRFN2

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_065788.1 Gene:LRFN2 / 57497 HGNCID:21226 Length:789 Species:Homo sapiens


Alignment Length:651 Identity:131/651 - (20%)
Similarity:219/651 - (33%) Gaps:201/651 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QLGGSILI-------GNYNYLTQLEVCENEMEVLDLSSLAQLETLK---CSRNKLMEL---IING 108
            :|||:.:|       .|...|..|.:..|.:..:...|...||:|:   ...|:|..|   .:.|
Human    58 RLGGNFIIHISRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTLRG 122

  Fly   109 -TNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNW--VGACASLTAINASHNRLN 170
             .|||.|:.::|.|..|:........|.|:.:|:|:||...|| |  |....:|..::..||.|:
Human   123 LVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLP-WDSVRRMVNLHQLSLDHNLLD 186

  Fly   171 NVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSL-PDNFFAVTHARLET 234
            ::|              :..:.||::|.:          |.|.||.|..| ||..||.:.|    
Human   187 HIA--------------EGTFADLQKLAR----------LDLTSNRLQKLPPDPIFARSQA---- 223

  Fly   235 LNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLH-NAAKLRVLHLAYNRIGVLPAACV 298
                 :.|:..|      .|..::.|..||        ||| |...|.:..|..:          
Human   224 -----SALTATP------FAPPLSFSFGGN--------PLHCNCELLWLRRLERD---------- 259

  Fly   299 RNWPELEIL----VLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHL 359
               .:||..    .|.|.....:.||.               .:|.|.|.         ..|.| 
Human   260 ---DDLETCGSPGGLKGRYFWHVREEE---------------FVCEPPLI---------TQHTH- 296

  Fly   360 DRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQR-HWSLVD---VSGNNRAALPTTKI 420
                          |.|.|.|    |....:.|.....|.. ||...|   |..::|.|:.....
Human   297 --------------KLLVLEG----QAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGT 343

  Fly   421 RQVSAQRNQNKTSGPWTMGFAETPGSGDCR-KLSVYQL---------------RAANYGGSDEAL 469
            ..:....:|:  ||.:|...|...|..... ::|:.||               |.::..||.:..
Human   344 LDIFITTSQD--SGAFTCIAANAAGEATAMVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTS 406

  Fly   470 YGMFEALEGRG-------RAAQEMSHLVPDLMKQEQMVKDSAVRDYMKFTLLAAQQQCGSVRSAA 527
            .|      |.|       ::..|.:.||.::.....:||.|..:...:..:...|..|..  ...
Human   407 RG------GGGSGGGEPPKSPPERAVLVSEVTTTSALVKWSVSKSAPRVKMYQLQYNCSD--DEV 463

  Fly   528 LFHLTRTRAPSKVRPLKSKRYVL-RMASTGGLDAYLIRRTSQLRLTKPDVIQKDQIHSMPDPHVL 591
            |.:        ::.|..:|.:|: .:.|..|.|..::                    :|.|....
Human   464 LIY--------RMIPASNKAFVVNNLVSGTGYDLCVL--------------------AMWDDTAT 500

  Fly   592 ELILSNDDEYLVVGNAQLWSVMDIDRAAREIRKEENSLLAAKRLVDIAQSFAAAESLSVIVVRFR 656
            .|..:|     :||.||.::..|..    :.:...:.:|....::.|.....|...:.::::..|
Human   501 TLTATN-----IVGCAQFFTKADYP----QCQSMHSQILGGTMILVIGGIIVATLLVFIVILMVR 556

  Fly   657 H 657
            :
Human   557 Y 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/25 (28%)
LRR_8 109..169 CDD:290566 20/61 (33%)
leucine-rich repeat 111..135 CDD:275380 6/23 (26%)
leucine-rich repeat 136..158 CDD:275380 9/23 (39%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 3/24 (13%)
LRR_8 205..266 CDD:290566 17/61 (28%)
leucine-rich repeat 210..230 CDD:275380 10/20 (50%)
leucine-rich repeat 232..255 CDD:275380 2/22 (9%)
LRR_RI <256..410 CDD:238064 31/162 (19%)
leucine-rich repeat 256..276 CDD:275380 6/20 (30%)
LRR_8 279..359 CDD:290566 12/83 (14%)
leucine-rich repeat 280..303 CDD:275380 2/22 (9%)
leucine-rich repeat 304..348 CDD:275380 9/47 (19%)
leucine-rich repeat 349..372 CDD:275380 2/22 (9%)
PP2Cc 461..655 CDD:294085 32/201 (16%)
LRFN2NP_065788.1 LRR 1 53..74 4/15 (27%)
leucine-rich repeat 54..77 CDD:275380 5/18 (28%)
LRR_8 76..136 CDD:316378 16/59 (27%)
LRR 2 77..98 4/20 (20%)
leucine-rich repeat 78..101 CDD:275380 5/22 (23%)
LRR 3 101..122 4/20 (20%)
leucine-rich repeat 102..125 CDD:275380 5/22 (23%)
LRR_8 125..185 CDD:316378 20/60 (33%)
LRR 4 125..146 7/20 (35%)
leucine-rich repeat 126..150 CDD:275380 6/23 (26%)
LRR 5 150..171 9/21 (43%)
leucine-rich repeat 151..174 CDD:275380 9/23 (39%)
LRR_8 174..>215 CDD:316378 14/64 (22%)
LRR 6 174..195 5/34 (15%)
leucine-rich repeat 175..198 CDD:275380 7/36 (19%)
LRR 7 198..219 9/30 (30%)
LRRCT 242..286 CDD:214507 13/79 (16%)
Ig 303..376 CDD:325142 16/78 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..424 6/46 (13%)
fn3 420..493 CDD:306538 15/102 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..602
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 619..654
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 668..702
PDZ-binding 786..789
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.