DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Phlpp and adcy1b

DIOPT Version :9

Sequence 1:	NP_001260558.1	Gene:	Phlpp / 35178	FlyBaseID:	FBgn0032749	Length:	954	Species:	Drosophila melanogaster
Sequence 2:	NP_001161822.1	Gene:	adcy1b / 569499	ZFINID:	ZDB-GENE-100805-1	Length:	1114	Species:	Danio rerio

Alignment Length:	66	Identity:	19/66 - (28%)
Similarity:	31/66 - (46%)	Gaps:	19/66 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    76 CENEMEVLDLSS--------LAQLETLK---------CSRNKLMELIINGTNLQTLVADHNYLHN 123
            ||:|.:..:|.:        |.|..|||         ||.: |:||:::||.|......|. :|:
Zfish    25 CEDEFDCAELEALFRRYRLKLEQTATLKALSVLILLSCSLS-LLELLLSGTGLSVAQGSHP-VHS 87

  Fly   124 I 124
            :
Zfish    88 V 88

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Phlpp	NP_001260558.1	leucine-rich repeat	91..110	CDD:275380	9/27 (33%)
		LRR_8	109..169	CDD:290566	4/16 (25%)
		leucine-rich repeat	111..135	CDD:275380	3/14 (21%)
		leucine-rich repeat	136..158	CDD:275380
		leucine-rich repeat	159..183	CDD:275380
		leucine-rich repeat	184..209	CDD:275380
		LRR_8	205..266	CDD:290566
		leucine-rich repeat	210..230	CDD:275380
		leucine-rich repeat	232..255	CDD:275380
		LRR_RI	<256..410	CDD:238064
		leucine-rich repeat	256..276	CDD:275380
		LRR_8	279..359	CDD:290566
		leucine-rich repeat	280..303	CDD:275380
		leucine-rich repeat	304..348	CDD:275380
		leucine-rich repeat	349..372	CDD:275380
		PP2Cc	461..655	CDD:294085
adcy1b	NP_001161822.1	AC_N	<128..270	CDD:292831
		CYCc	236..431	CDD:214485
		Guanylate_cyc	272..454	CDD:278633
		DUF1053	498..585	CDD:283888
		CYCc	806..1012	CDD:214485
		Guanylate_cyc	839..1035	CDD:278633
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900