Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005165413.1 | Gene: | npr3 / 569395 | ZFINID: | ZDB-GENE-060531-91 | Length: | 503 | Species: | Danio rerio |
Alignment Length: | 232 | Identity: | 43/232 - (18%) |
---|---|---|---|
Similarity: | 82/232 - (35%) | Gaps: | 61/232 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 LIGNYNYLTQLEVCENEMEVLD----LSSLAQLE-TLKCSRNKLMELIINGTNLQTLVADHNYLH 122
Fly 123 NISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSL 187
Fly 188 DLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNN 252
Fly 253 HAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNR 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 3/19 (16%) |
LRR_8 | 109..169 | CDD:290566 | 9/59 (15%) | ||
leucine-rich repeat | 111..135 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 136..158 | CDD:275380 | 3/21 (14%) | ||
leucine-rich repeat | 159..183 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 184..209 | CDD:275380 | 4/24 (17%) | ||
LRR_8 | 205..266 | CDD:290566 | 10/60 (17%) | ||
leucine-rich repeat | 210..230 | CDD:275380 | 3/19 (16%) | ||
leucine-rich repeat | 232..255 | CDD:275380 | 3/22 (14%) | ||
LRR_RI | <256..410 | CDD:238064 | 8/34 (24%) | ||
leucine-rich repeat | 256..276 | CDD:275380 | 4/19 (21%) | ||
LRR_8 | 279..359 | CDD:290566 | 4/11 (36%) | ||
leucine-rich repeat | 280..303 | CDD:275380 | 4/10 (40%) | ||
leucine-rich repeat | 304..348 | CDD:275380 | |||
leucine-rich repeat | 349..372 | CDD:275380 | |||
PP2Cc | 461..655 | CDD:294085 | |||
npr3 | XP_005165413.1 | Periplasmic_Binding_Protein_Type_1 | 29..416 | CDD:299141 | 43/232 (19%) |
ANF_receptor | 46..389 | CDD:279440 | 43/232 (19%) | ||
TM_EphA1 | 436..468 | CDD:214014 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |