DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and npr3

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:232 Identity:43/232 - (18%)
Similarity:82/232 - (35%) Gaps:61/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LIGNYNYLTQLEVCENEMEVLD----LSSLAQLE-TLKCSRNKLMELIINGTNLQTLVADHNYLH 122
            ::..|:..|...|..:..|.:|    ::|:...| .:.||:..::..::...:.:.|.:|.:...
Zfish   190 VLSEYHISTDFAVLNSNEERVDPDGIITSVYGSEVVIMCSKADIVRDLMLAAHRRKLTSDSHIFF 254

  Fly   123 NISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSL 187
            ||...|:.           |:.:.|    |...........|:::.||.|.:|    |.|:    
Zfish   255 NIELFNSS-----------SYGDGS----WRRRDKYDDEARAAYSFLNTVTLL----RSTK---- 296

  Fly   188 DLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNN 252
                      .:| |.||......||.:.:|                   .|...|.:..:.:..
Zfish   297 ----------PEF-EDFSIEMKKSLQQSNIP-------------------ICEDCSAVNMFMEGF 331

  Fly   253 HAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNR 289
            |.||:..::|   |.:...:.|.....|.:.|..:||
Zfish   332 HDALLLYAIA---LREVKSKGLTKKNGLEITHSMWNR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 3/19 (16%)
LRR_8 109..169 CDD:290566 9/59 (15%)
leucine-rich repeat 111..135 CDD:275380 5/23 (22%)
leucine-rich repeat 136..158 CDD:275380 3/21 (14%)
leucine-rich repeat 159..183 CDD:275380 6/23 (26%)
leucine-rich repeat 184..209 CDD:275380 4/24 (17%)
LRR_8 205..266 CDD:290566 10/60 (17%)
leucine-rich repeat 210..230 CDD:275380 3/19 (16%)
leucine-rich repeat 232..255 CDD:275380 3/22 (14%)
LRR_RI <256..410 CDD:238064 8/34 (24%)
leucine-rich repeat 256..276 CDD:275380 4/19 (21%)
LRR_8 279..359 CDD:290566 4/11 (36%)
leucine-rich repeat 280..303 CDD:275380 4/10 (40%)
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 43/232 (19%)
ANF_receptor 46..389 CDD:279440 43/232 (19%)
TM_EphA1 436..468 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.