DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and adcy7

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_021333246.1 Gene:adcy7 / 568726 ZFINID:ZDB-GENE-040713-1 Length:1119 Species:Danio rerio


Alignment Length:425 Identity:93/425 - (21%)
Similarity:144/425 - (33%) Gaps:105/425 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DPYKSKLKVSASHSGPHPLPV------EVTAAEEE----QAATFGQTSPQKLSLKGSQLGG---- 60
            |.:...|:...|...| ||..      :.|..:||    ...|....|..|..:|..::.|    
Zfish   534 DSFDESLEEPFSLPAP-PLSTYNRNKSQKTKFDEELHDKMTTTINDLSSSKQWVKSEEISGLTLW 597

  Fly    61 -----------SILIGNYNY----LTQLEVCENEMEVLDLSSLAQL----ETLKCSRNKLMELII 106
                       :|.:.|:.|    .|.:.:|...:::|......:|    ..|.|     ..|:|
Zfish   598 FTKKDLEMQYRTIEMPNFKYYIGCATFIFICIFIIQMLVTKQRIELGLGFAVLAC-----FLLLI 657

  Fly   107 NGTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNN 171
                |....|||                 :||:         .|..:.:|..|.|::.:..:...
Zfish   658 ----LCICFADH-----------------IQRM---------FPEKLKSCTWLLALSKAVVKRPF 692

  Fly   172 VAVLLRNYRITELVSLDLAYNDLKQLD------QFPEGFSSIRSLQLQSNELPSLPDNFFAVTHA 230
            |.:||.....|.:|.:.:....||:.|      |....|:.....:||  .||.|..|......|
Zfish   693 VRILLATVATTVIVVIAMFELFLKKTDNLCDLLQQNSSFADSARDELQ--YLPYLVYNCILALIA 755

  Fly   231 RLETLNVSCN-KLS----------TLPRYEQNNHAALVNLSLAGNH-LNDSIFEPLHNAAK-LRV 282
            ....|.||.. ||:          |:..|.|.|..:..|..|..|| ..||:........| .::
Zfish   756 CGVFLRVSFELKLAFLLIVSLVSYTIILYSQENLFSNYNCLLYTNHSCGDSLMVCKAGLMKHPKI 820

  Fly   283 LHLAYNRIGVLPAACVRNWPEL----EILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQL 343
            :...|..:.:.....:....|.    :.|:.:.|:..:  |||.....|      |.|||.....
Zfish   821 MSCIYITLFLFTMLLISRQNEYCCRQDFLLKNKNLADK--EEVELCENL------NRLLLENVLP 877

  Fly   344 AKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDL 378
            |.:|.|.|   ..|..:.|.||:.:...|.||.||
Zfish   878 AHVAALFV---GENKKNEVGLLSAISLLNRKYKDL 909

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/22 (23%)
LRR_8 109..169 CDD:290566 10/59 (17%)
leucine-rich repeat 111..135 CDD:275380 4/23 (17%)
leucine-rich repeat 136..158 CDD:275380 4/21 (19%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 6/30 (20%)
LRR_8 205..266 CDD:290566 20/72 (28%)
leucine-rich repeat 210..230 CDD:275380 6/19 (32%)
leucine-rich repeat 232..255 CDD:275380 9/33 (27%)
LRR_RI <256..410 CDD:238064 32/129 (25%)
leucine-rich repeat 256..276 CDD:275380 6/20 (30%)
LRR_8 279..359 CDD:290566 18/84 (21%)
leucine-rich repeat 280..303 CDD:275380 1/22 (5%)
leucine-rich repeat 304..348 CDD:275380 11/47 (23%)
leucine-rich repeat 349..372 CDD:275380 6/22 (27%)
PP2Cc 461..655 CDD:294085
adcy7XP_021333246.1 AC_N <129..248 CDD:318454
Guanylate_cyc 272..455 CDD:306677
DUF1053 487..613 CDD:310728 15/79 (19%)
Guanylate_cyc 909..1106 CDD:306677 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.