Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021333533.1 | Gene: | si:dkey-1h4.4 / 566734 | ZFINID: | ZDB-GENE-160728-41 | Length: | 251 | Species: | Danio rerio |
Alignment Length: | 256 | Identity: | 69/256 - (26%) |
---|---|---|---|
Similarity: | 115/256 - (44%) | Gaps: | 36/256 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 LEVCENEMEVLDLS---------SLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTN 128
Fly 129 THPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYND 193
Fly 194 LKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNH-AALV 257
Fly 258 NLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLP 318 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 6/18 (33%) |
LRR_8 | 109..169 | CDD:290566 | 14/59 (24%) | ||
leucine-rich repeat | 111..135 | CDD:275380 | 3/23 (13%) | ||
leucine-rich repeat | 136..158 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 159..183 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 184..209 | CDD:275380 | 5/24 (21%) | ||
LRR_8 | 205..266 | CDD:290566 | 21/61 (34%) | ||
leucine-rich repeat | 210..230 | CDD:275380 | 5/19 (26%) | ||
leucine-rich repeat | 232..255 | CDD:275380 | 11/23 (48%) | ||
LRR_RI | <256..410 | CDD:238064 | 19/63 (30%) | ||
leucine-rich repeat | 256..276 | CDD:275380 | 7/19 (37%) | ||
LRR_8 | 279..359 | CDD:290566 | 11/40 (28%) | ||
leucine-rich repeat | 280..303 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 304..348 | CDD:275380 | 5/15 (33%) | ||
leucine-rich repeat | 349..372 | CDD:275380 | |||
PP2Cc | 461..655 | CDD:294085 | |||
si:dkey-1h4.4 | XP_021333533.1 | leucine-rich repeat | 16..34 | CDD:275380 | 3/17 (18%) |
LRR | <32..>238 | CDD:227223 | 64/232 (28%) | ||
leucine-rich repeat | 38..60 | CDD:275380 | 8/40 (20%) | ||
leucine-rich repeat | 61..83 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 84..106 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 107..129 | CDD:275380 | 4/21 (19%) | ||
leucine-rich repeat | 130..152 | CDD:275380 | 5/21 (24%) | ||
leucine-rich repeat | 153..175 | CDD:275380 | 11/23 (48%) | ||
leucine-rich repeat | 176..198 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 199..222 | CDD:275380 | 6/22 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45752 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |