DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Shoc2

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001161977.1 Gene:Shoc2 / 56392 MGIID:1927197 Length:582 Species:Mus musculus


Alignment Length:593 Identity:136/593 - (22%)
Similarity:214/593 - (36%) Gaps:182/593 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KQADPYKSKLKVSASHSG-----------PHPLP------------VEVTAAEEEQAATFGQTSP 48
            |..|....|.:.||:..|           |:|.|            .|:....||.:        
Mouse    46 KGKDAKDGKKESSAAQPGVAFSVDNTIKRPNPAPGTRKKSSNAEVIKELNKCREENS-------- 102

  Fly    49 QKLSLKGSQLGGSIL---IGNYNYLTQLEVCENEMEVL--DLSSLAQLETLKCSRNKLMEL---I 105
            .:|.|  |:....||   :.....||:|.:..|:::.|  ::..|..|.||..|.|.|..|   :
Mouse   103 MRLDL--SKRSIHILPPSVKELTQLTELYLYSNKLQSLPAEVGCLVNLMTLALSENSLTSLPDSL 165

  Fly   106 INGTNLQTLVADHNYLHNI--------STTNTH--------------PVPLKLQRIDISHNNFSE 148
            .|...|:.|...||.|..|        |.|..:              .:| ||..:.|..|...:
Mouse   166 DNLKKLRMLDLRHNKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLP-KLSMLSIRENKIKQ 229

  Fly   149 LPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQ 213
            ||..:|...:|..::.:||:|.::...:.|  .|::.:|||.:|||..|.......||:..|.|:
Mouse   230 LPAEIGELCNLITLDVAHNQLEHLPKEIGN--CTQITNLDLQHNDLLDLPDTIGNLSSLNRLGLR 292

  Fly   214 SNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHL------NDSIFE 272
            .|.|.::|.:.  ...:.||.||:..|.:||||....::...|.:|:||.|..      ..|.|.
Mouse   293 YNRLSAIPRSL--AKCSALEELNLENNNISTLPESLLSSLVKLNSLTLARNCFQLYPVGGPSQFS 355

  Fly   273 PLHNAAKLRVLHLAYNRIGVLPAACVR-----------------------NWPELEILVLSGNML 314
            .:::      |::.:|||..:|.....                       .|..:..|.|:.|.|
Mouse   356 TIYS------LNMEHNRINKIPFGIFSRAKVLSKLNMKDNQLTSLPLDFGTWTSMVELNLATNQL 414

  Fly   315 QQLPEEVATLGQLRVLRCCNNLLLCTPQ-LAKLAMLKVLDLSHNHLDRV---------------- 362
            .::||:|:.|..|.||...||||...|. |..|..|:.|||..|.|:.:                
Mouse   415 TKIPEDVSGLVSLEVLILSNNLLKKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLT 479

  Fly   363 -NLLALVPS-----RNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIR 421
             |.|:.:|.     .||.:|.|..||...:.|:               :....|         :.
Mouse   480 NNQLSTLPRGIGHLTNLTHLGLGENLLTHLPEE---------------IGTLEN---------LE 520

  Fly   422 QVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALEGRGRAAQEM 486
            ::....|.|..|.|:.:..        |.|||:..:...                        .:
Mouse   521 ELYLNDNPNLHSLPFELAL--------CSKLSIMSIENC------------------------PL 553

  Fly   487 SHLVPDLM 494
            |||.|.::
Mouse   554 SHLPPQIV 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 8/21 (38%)
LRR_8 109..169 CDD:290566 19/81 (23%)
leucine-rich repeat 111..135 CDD:275380 9/45 (20%)
leucine-rich repeat 136..158 CDD:275380 6/21 (29%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 9/24 (38%)
LRR_8 205..266 CDD:290566 21/60 (35%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 9/22 (41%)
LRR_RI <256..410 CDD:238064 47/205 (23%)
leucine-rich repeat 256..276 CDD:275380 7/25 (28%)
LRR_8 279..359 CDD:290566 29/103 (28%)
leucine-rich repeat 280..303 CDD:275380 6/45 (13%)
leucine-rich repeat 304..348 CDD:275380 18/44 (41%)
leucine-rich repeat 349..372 CDD:275380 9/44 (20%)
PP2Cc 461..655 CDD:294085 4/34 (12%)
Shoc2NP_001161977.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 9/41 (22%)
LRR 1 101..122 5/30 (17%)
leucine-rich repeat 104..124 CDD:275380 5/21 (24%)
PLN00113 <115..>483 CDD:215061 98/378 (26%)
LRR 2 124..145 5/20 (25%)
leucine-rich repeat 125..147 CDD:275380 6/21 (29%)
LRR 3 147..169 8/21 (38%)
leucine-rich repeat 148..170 CDD:275380 8/21 (38%)
LRR 4 170..191 6/20 (30%)
leucine-rich repeat 171..193 CDD:275380 6/21 (29%)
LRR 5 193..215 2/21 (10%)
leucine-rich repeat 194..216 CDD:275380 2/22 (9%)
LRR 6 216..237 7/20 (35%)
leucine-rich repeat 217..239 CDD:275380 6/21 (29%)
LRR 7 239..260 5/22 (23%)
leucine-rich repeat 240..262 CDD:275380 5/23 (22%)
LRR 8 262..283 7/20 (35%)
leucine-rich repeat 263..285 CDD:275380 7/21 (33%)
LRR 9 285..307 6/23 (26%)
leucine-rich repeat 286..332 CDD:275380 14/47 (30%)
LRR 10 308..329 9/20 (45%)
LRR 11 332..353 5/20 (25%)
leucine-rich repeat 333..380 CDD:275380 12/52 (23%)
LRR 12 356..377 5/26 (19%)
LRR 13 380..400 0/19 (0%)
leucine-rich repeat 381..403 CDD:275380 1/21 (5%)
LRR 14 403..424 7/20 (35%)
leucine-rich repeat 404..426 CDD:275380 8/21 (38%)
LRR 15 426..448 9/21 (43%)
leucine-rich repeat 427..449 CDD:275380 10/21 (48%)
LRR 16 449..470 6/20 (30%)
leucine-rich repeat 450..472 CDD:275380 6/21 (29%)
PLN03150 <453..527 CDD:178695 16/97 (16%)
LRR 17 472..494 3/21 (14%)
leucine-rich repeat 473..495 CDD:275380 3/21 (14%)
LRR 18 495..516 7/35 (20%)
leucine-rich repeat 496..519 CDD:275380 7/46 (15%)
LRR 19 518..540 5/38 (13%)
LRR 20 542..563 7/44 (16%)
leucine-rich repeat 543..563 CDD:275380 6/43 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9772
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.