DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and si:dkey-206f10.1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_009293230.1 Gene:si:dkey-206f10.1 / 560719 ZFINID:ZDB-GENE-041014-154 Length:1187 Species:Danio rerio


Alignment Length:500 Identity:93/500 - (18%)
Similarity:166/500 - (33%) Gaps:164/500 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NLQTLVADH-NYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLT-AINASHNRLNNV 172
            :|..:.|:| ...||....|      |......|:.::::||. ..||.|:: .||   .|:.:.
Zfish   570 DLNEMEAEHPKTRHNNRPWN------KEILASFSNGSYTQLPT-SSACRSMSKEIN---KRIEHA 624

  Fly   173 AVLLRNYRITE--LVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETL 235
            ..|..:.|:.:  :..:.|.:.|.    ...|.||.:|....::|    |..:|..:      .|
Zfish   625 IDLRSSERMRQEHITPVTLVFKDA----HIEEKFSQVRDEMFKTN----LVCSFIML------LL 675

  Fly   236 NVSCNKLSTLPR------------------------------------------YEQNNHAALVN 258
            .::...|..:||                                          :|.|:...|:.
Zfish   676 LMAVQALIPVPRMYLWTVLQFCLFLLGYLLLLVMVLAEEFKHSPGVLQQFCCWIHENNSMRNLLT 740

  Fly   259 LSLAGNHLNDSIFEPLH-NAAKLRVLHLAYN---RIGVLP-AACVRNWPELEILVLSGNMLQQLP 318
            ::....:...::|:.:. |:::::.:.....   :.|..| .||  .:|  |:.||||       
Zfish   741 ITAIAMNFGMALFDMMWCNSSEMKEISTRETEGYKAGQKPLTAC--TYP--EVFVLSG------- 794

  Fly   319 EEVATLGQLRVLRCCNNLLLCTPQLAKLA-----------MLKVLDLSHNHLDRVNLL------- 365
              |.::....|....::||..|..|..:|           ||.|....|.||.|.:.|       
Zfish   795 --VVSMVTCAVFLRMSSLLKLTILLFVVAVYTYFIEVSFHMLYVHQQEHEHLSRSHFLRRKGVSI 857

  Fly   366 ---------ALVPSRNLK---YLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTT 418
                     .|...|..:   .||....||.|.:.|:.:             |:..:|...|...
Zfish   858 LLMAMFMIAVLYNGRRWEATTRLDFLWRLQAQQEVQEMR-------------DLREHNECLLHNI 909

  Fly   419 KIRQVS---AQRNQN------KTSGPWTMGFAETPGSGDCRKLSVYQLRAANYGG---------- 464
            ....|:   .:||:|      ::.....:.||...|..|     .|:.:...:.|          
Zfish   910 LPAHVARHFLERNRNDQELYSQSYDEVGVMFASIAGFND-----YYEQKEIKHEGVECLKLLNEI 969

  Fly   465 -------SDEALYGMFEALEGRGRAAQEMSHLVPDLMKQEQMVKD 502
                   .:|:.:...|.::..|......|.|.||  ||.::|.|
Zfish   970 IADFDELLEESYFLDIEKIKTIGSCYMAASGLSPD--KQSRVVND 1012

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 92/499 (18%)
LRR_8 109..169 CDD:290566 15/60 (25%)
leucine-rich repeat 111..135 CDD:275380 6/24 (25%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 5/24 (21%)
leucine-rich repeat 184..209 CDD:275380 5/24 (21%)
LRR_8 205..266 CDD:290566 12/102 (12%)
leucine-rich repeat 210..230 CDD:275380 3/19 (16%)
leucine-rich repeat 232..255 CDD:275380 6/64 (9%)
LRR_RI <256..410 CDD:238064 37/188 (20%)
leucine-rich repeat 256..276 CDD:275380 2/20 (10%)
LRR_8 279..359 CDD:290566 21/94 (22%)
leucine-rich repeat 280..303 CDD:275380 4/26 (15%)
leucine-rich repeat 304..348 CDD:275380 12/54 (22%)
leucine-rich repeat 349..372 CDD:275380 8/38 (21%)
PP2Cc 461..655 CDD:294085 11/58 (19%)
si:dkey-206f10.1XP_009293230.1 AC_N <135..380 CDD:292831
CYCc 343..538 CDD:214485
Guanylate_cyc 382..564 CDD:278633
DUF1053 <611..661 CDD:283888 12/56 (21%)
CYCc 899..1097 CDD:214485 22/120 (18%)
Guanylate_cyc 928..1126 CDD:278633 16/91 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.