DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and si:ch211-132f19.7

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_688903.4 Gene:si:ch211-132f19.7 / 560410 ZFINID:ZDB-GENE-130530-619 Length:1183 Species:Danio rerio


Alignment Length:511 Identity:107/511 - (20%)
Similarity:161/511 - (31%) Gaps:160/511 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 SGNNRAALPTTKI------------------RQVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSV 454
            ||..|.:|..|.:                  ..|.:|..       |..|.....|:..|    |
Zfish   148 SGQRRTSLVVTNVIDILTKLHIIFIYLALAPEMVDSQHG-------WLAGLLMALGAIIC----V 201

  Fly   455 YQLRAANYGGSDEALY-GMFEALEGRGRAAQEMSHLVPDLMKQEQMVKDSAVRDYMKFTLLAAQ- 517
            ..|........|...| |:...|   .:..|.:..||..|...:..        |:.|||.|.. 
Zfish   202 LVLTCKGLMSPDYLRYAGLASWL---SQTVQALGGLVYGLETDQSW--------YVLFTLFAIYT 255

  Fly   518 --------QQCGSVRSAALFHLTRT----RAPSKVRPLKSKRYVLRMASTGGL-----------D 559
                    ..|....:|||.....|    ...:.||.|.:|..:....:|.||           .
Zfish   256 LLPLPLLWSICMGFLTAALHLFVDTFKNYNDTAIVRKLLAKGLLYMGMNTAGLFIHYLSDRAQRQ 320

  Fly   560 AYLIRR---TSQLRLTKPDVIQKDQIHS-MPDPHVLELI---LSNDDEYL--------------- 602
            |:|..|   ..::::.:.:..|:..:.| :|....:|:|   .:.|||.|               
Zfish   321 AFLETRRCIEGRVKMERENQRQERLVMSILPRFIAMEMIGDMTALDDELLPQQFHKTYFHQYKDV 385

  Fly   603 ------VVGNAQLWSVMDIDRAAREIRK---------EENSLLAAKRLVD------------IAQ 640
                  :.|...|...|......|.:.:         |||..:..|.|.|            .|.
Zfish   386 SILFADIKGFTSLSMTMPAQELVRTLNELFGRFDRLAEENHCMRIKILGDCYYCVSGVPEPQTAH 450

  Fly   641 SFAAAE-SLSVI-VVRF--RHLGTDVDHLIRELKQSV------RKKPQ--------PVSLPLSSG 687
            :....| .|::| .:|:  :.|..|:|..|.....||      .:|.|        .|:..|.:|
Zfish   451 ARCCVEMGLAMINTIRYVRKELKRDMDMRIGIHSGSVLCGVLGLQKWQFDVWSWDVDVANMLEAG 515

  Fly   688 SVCKRTCCDRSNA-CRHRAIEQEPLAGRSSPSGQSDRDLLAKDKDDEFVLAHARVLQEEQQLEML 751
            .:..|....|:.. |.....|.|  .||    |....:.|.|.|.|.|::.|..  |::::...:
Zfish   516 GIPGRIHISRATLDCLEGVYETE--EGR----GHERNEFLRKHKIDTFLIRHTP--QDDKEPPKV 572

  Fly   752 DETESVSESVLSEEQFKCWEYMLEQNTQLLFDK--ELNTISKSFTKQRTV--PNAI 803
            ..| |..|:..|.|              |.||.  .:|.|..:||....|  ||.|
Zfish   573 RRT-SKDETTWSAE--------------LPFDNIIGMNCILATFTNGSLVHLPNQI 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064 1/1 (100%)
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085 51/269 (19%)
si:ch211-132f19.7XP_688903.4 AC_N <133..375 CDD:292831 50/248 (20%)
CYCc 338..537 CDD:214485 38/198 (19%)
Guanylate_cyc 381..559 CDD:278633 39/183 (21%)
DUF1053 579..667 CDD:283888 14/49 (29%)
CYCc 903..1103 CDD:214485
Guanylate_cyc 932..1131 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.