| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_060887.2 | Gene: | ADCY10 / 55811 | HGNCID: | 21285 | Length: | 1610 | Species: | Homo sapiens |
| Alignment Length: | 343 | Identity: | 71/343 - (20%) |
|---|---|---|---|
| Similarity: | 125/343 - (36%) | Gaps: | 90/343 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 81 EVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNIS------TTNTHPVPLKLQRI 139
Fly 140 DISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDL-KQLDQF-PE 202
Fly 203 GFSSI--------RSL---------QLQSNELPSLP-DNFFAVTHARLETLNV-----------S 238
Fly 239 CN-----KLSTLPRYEQNNHAALVNL-SLAGNH--------------LNDSIFE--PLHNAAKLR 281
Fly 282 VLHLA----------YNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLG---QLRVLRC- 332
Fly 333 ---CNNLLLCTPQLAKLA 347 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 4/18 (22%) |
| LRR_8 | 109..169 | CDD:290566 | 11/65 (17%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | 3/29 (10%) | ||
| leucine-rich repeat | 136..158 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 4/23 (17%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 9/34 (26%) | ||
| LRR_8 | 205..266 | CDD:290566 | 17/109 (16%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 6/29 (21%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 6/38 (16%) | ||
| LRR_RI | <256..410 | CDD:238064 | 30/126 (24%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 7/36 (19%) | ||
| LRR_8 | 279..359 | CDD:290566 | 22/86 (26%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 5/32 (16%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | 15/51 (29%) | ||
| leucine-rich repeat | 349..372 | CDD:275380 | |||
| PP2Cc | 461..655 | CDD:294085 | |||
| ADCY10 | NP_060887.2 | CHD | 40..214 | CDD:143636 | |
| AcyC | <42..197 | CDD:225025 | |||
| CHD | 292..461 | CDD:143636 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||