DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and adcy2b

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_005170095.1 Gene:adcy2b / 557902 ZFINID:ZDB-GENE-060503-69 Length:1142 Species:Danio rerio


Alignment Length:418 Identity:80/418 - (19%)
Similarity:137/418 - (32%) Gaps:161/418 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 RIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLR-NYRITELVSLD--LAYNDL----- 194
            :|..|.||...||.::.:|. |..|:.|        |.|| ||.:..::.|.  :|||.:     
Zfish   772 QITNSSNNKFYLPYFIYSCI-LGLISCS--------VFLRINYELKMIIMLGAVVAYNIIILQTH 827

  Fly   195 -KQLDQFPEGFSSIRSLQLQSNELPSLPD-------------NFFAVT----------HARLETL 235
             ..||.:        |:.|...:.|..|.             ..|.||          :.||:.|
Zfish   828 ASILDDY--------SMALYKTQQPDRPGVLKDLKTMGSISLFIFFVTLLVLARQNEYYCRLDFL 884

  Fly   236 -----NVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPA 295
                 ...|.::.|:   |..|...|.|:..|                     |:|.:.:|    
Zfish   885 WRNKFKKECEEIETM---ENLNRVLLENVLPA---------------------HVAEHFLG---- 921

  Fly   296 ACVRNWPELEILVLSGN----MLQQLPE--------EVATLGQLRVLRCCNNL------LLCTPQ 342
               |||...::...|.:    |...:|:        :|...| |..||..|.:      ||..|:
Zfish   922 ---RNWKNEDLYHQSYDTVCVMFASIPDFKEFYTESDVNKEG-LECLRLLNEIIADFDELLSKPK 982

  Fly   343 LAKLAMLKVLDLSHNHLDRVNL---LALVPSRNLKYLD----------LSGNLQLQVDEQQFK-- 392
            .:.:..:|.:..::.....:|:   |......:.:|:.          |.|.|.: :::..|.  
Zfish   983 FSGVEKIKTIGSTYMAATGLNVTPGLEYAQYHDRQYMHIGTMVEFAFALVGKLDV-INKHSFNDF 1046

  Fly   393 --------------VCQSQSQRHWSLVDVSGNN---RAALPTTKIR---QVSAQRNQNKTSGPWT 437
                          |..:|..::    |:.||.   .:.:.:|.:.   ||:.:.|       |.
Zfish  1047 RMRVGINHGPVIAGVIGAQKPQY----DIWGNTVNVASRMESTGVLGKIQVTEETN-------WI 1100

  Fly   438 M----------GFAETPGSGDCRKLSVY 455
            :          |.....|.||.|...|:
Zfish  1101 LQTLGYMCSCRGIINVKGKGDLRTFFVH 1128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 10/30 (33%)
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380 7/19 (37%)
leucine-rich repeat 159..183 CDD:275380 8/24 (33%)
leucine-rich repeat 184..209 CDD:275380 6/32 (19%)
LRR_8 205..266 CDD:290566 17/88 (19%)
leucine-rich repeat 210..230 CDD:275380 6/42 (14%)
leucine-rich repeat 232..255 CDD:275380 6/27 (22%)
LRR_RI <256..410 CDD:238064 32/200 (16%)
leucine-rich repeat 256..276 CDD:275380 3/19 (16%)
LRR_8 279..359 CDD:290566 19/97 (20%)
leucine-rich repeat 280..303 CDD:275380 6/22 (27%)
leucine-rich repeat 304..348 CDD:275380 12/61 (20%)
leucine-rich repeat 349..372 CDD:275380 3/25 (12%)
PP2Cc 461..655 CDD:294085
adcy2bXP_005170095.1 AC_N <80..307 CDD:292831
CYCc 283..486 CDD:214485
Guanylate_cyc 328..512 CDD:278633
DUF1053 542..646 CDD:283888
CYCc 899..1106 CDD:214485 41/250 (16%)
Guanylate_cyc 929..1128 CDD:278633 35/211 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.