DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and LRRC40

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_060238.3 Gene:LRRC40 / 55631 HGNCID:26004 Length:602 Species:Homo sapiens


Alignment Length:621 Identity:140/621 - (22%)
Similarity:229/621 - (36%) Gaps:150/621 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GQTSPQKLSLKGSQLGGSILIGNYNYLTQLEVCENEMEVLDLSSLAQLETLK-------CSRNKL 101
            |.:.||.| ||.::..|.:.:...| |:::..|...:.| |:...|. :.|.       ..:..|
Human    24 GTSVPQGL-LKAARKSGQLNLSGRN-LSEVPQCVWRINV-DIPEEAN-QNLSFGATERWWEQTDL 84

  Fly   102 MELIINGTNLQTLVADHNYLHNISTTNTHPVPL-----------KLQRIDISHNNFSELPNWVGA 155
            .:|||:...||:|..|...|..::..:.|...|           .||::::|||....||..:..
Human    85 TKLIISNNKLQSLTDDLRLLPALTVLDIHDNQLTSLPSAIRELENLQKLNVSHNKLKILPEEITN 149

  Fly   156 CASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRS---LQLQSNEL 217
            ..:|..:...||.|..::....  :::.|..|||:.|.|..:   |..|||:.|   |.|.||||
Human   150 LRNLKCLYLQHNELTCISEGFE--QLSNLEDLDLSNNHLTTV---PASFSSLSSLVRLNLSSNEL 209

  Fly   218 PSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEP-LHNAAKLR 281
            .|||.....:  .||:.|:.:.|.|.|:|    ...|.:.:|.|.....|...|.| ..:.:.|:
Human   210 KSLPAEINRM--KRLKHLDCNSNLLETIP----PELAGMESLELLYLRRNKLRFLPEFPSCSLLK 268

  Fly   282 VLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKL 346
            .||:..|:|.:|.|..:::...:.:|.|..|.|:.:|:|:..|..|..|...||.:...|.....
Human   269 ELHVGENQIEMLEAEHLKHLNSILVLDLRDNKLKSVPDEIILLRSLERLDLSNNDISSLPYSLGN 333

  Fly   347 AMLKVLDLSHNHL--------------------------------------------DRVNLLAL 367
            ..||.|.|..|.|                                            .|||:.|:
Human   334 LHLKFLALEGNPLRTIRREIISKGTQEVLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIHAI 398

  Fly   368 VPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPT--------------- 417
            :   .||.||.|......:.::.|...:|...   :.::.|.|....:|.               
Human   399 I---TLKILDYSDKQATLIPDEVFDAVKSNIV---TSINFSKNQLCEIPKRMVELKEMVSDVDLS 457

  Fly   418 -TKIRQVSAQ------------RNQNKTSGPWTMGFAETPGSGDCRKLSVYQLRAANYGGS---- 465
             .|:..:|.:            ||....|.|..|.             |:.:|:..|...:    
Human   458 FNKLSFISLELCVLQKLTFLDLRNNFLNSLPEEME-------------SLVRLQTINLSFNRFKM 509

  Fly   466 -DEALYGMFEALEGRGRAAQEMSHLVPDLMKQEQMVKDSAVRDYMKFTLLAAQQQ---CGSVRSA 526
             .|.||.:| .||....:..::..:.|..||   |:::....|.....||....:   |.::|:.
Human   510 LPEVLYRIF-TLETILISNNQVGSVDPQKMK---MMENLTTLDLQNNDLLQIPPELGNCVNLRTL 570

  Fly   527 ALFHLTRTRAPSKVRPLKSKRYVLRMASTGGLDAYL 562
            .|          ...|.:..|..:.|..|..:..||
Human   571 LL----------DGNPFRVPRAAILMKGTAAILEYL 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/25 (20%)
LRR_8 109..169 CDD:290566 17/70 (24%)
leucine-rich repeat 111..135 CDD:275380 7/34 (21%)
leucine-rich repeat 136..158 CDD:275380 7/21 (33%)
leucine-rich repeat 159..183 CDD:275380 4/23 (17%)
leucine-rich repeat 184..209 CDD:275380 10/24 (42%)
LRR_8 205..266 CDD:290566 22/63 (35%)
leucine-rich repeat 210..230 CDD:275380 9/19 (47%)
leucine-rich repeat 232..255 CDD:275380 6/22 (27%)
LRR_RI <256..410 CDD:238064 42/198 (21%)
leucine-rich repeat 256..276 CDD:275380 5/20 (25%)
LRR_8 279..359 CDD:290566 24/79 (30%)
leucine-rich repeat 280..303 CDD:275380 7/22 (32%)
leucine-rich repeat 304..348 CDD:275380 12/43 (28%)
leucine-rich repeat 349..372 CDD:275380 10/66 (15%)
PP2Cc 461..655 CDD:294085 23/110 (21%)
LRRC40NP_060238.3 leucine-rich repeat 41..83 CDD:275380 7/44 (16%)
LRR 1 83..104 8/20 (40%)
LRR_8 84..140 CDD:316378 16/55 (29%)
leucine-rich repeat 84..106 CDD:275380 9/21 (43%)
LRR 2 106..127 2/20 (10%)
leucine-rich repeat 107..129 CDD:275380 2/21 (10%)
PLN00113 120..>577 CDD:331614 109/500 (22%)
LRR 3 129..150 7/20 (35%)
leucine-rich repeat 130..152 CDD:275380 7/21 (33%)
LRR 4 152..173 4/22 (18%)
leucine-rich repeat 153..175 CDD:275380 4/23 (17%)
LRR 5 175..196 9/23 (39%)
leucine-rich repeat 176..198 CDD:275380 10/24 (42%)
LRR 6 198..219 10/20 (50%)
leucine-rich repeat 199..221 CDD:275380 9/23 (39%)
LRR 7 221..242 8/24 (33%)
leucine-rich repeat 222..244 CDD:275380 7/25 (28%)
LRR 8 244..265 5/20 (25%)
leucine-rich repeat 245..266 CDD:275380 5/20 (25%)
LRR 9 266..286 7/19 (37%)
leucine-rich repeat 267..290 CDD:275380 7/22 (32%)
LRR 10 290..311 6/20 (30%)
leucine-rich repeat 291..313 CDD:275380 7/21 (33%)
LRR 11 313..335 5/21 (24%)
LRR 12 336..356 6/19 (32%)
LRR 13 400..421 6/20 (30%)
LRR 14 426..447 3/23 (13%)
leucine-rich repeat 447..473 CDD:275380 2/25 (8%)
LRR 15 450..472 2/21 (10%)
LRR 16 473..494 5/33 (15%)
leucine-rich repeat 474..496 CDD:275380 6/34 (18%)
LRR 17 496..517 5/20 (25%)
leucine-rich repeat 497..543 CDD:275380 12/49 (24%)
LRR 18 519..540 5/23 (22%)
LRR 19 543..564 3/20 (15%)
leucine-rich repeat 544..566 CDD:275380 4/21 (19%)
LRR 20 566..586 4/29 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45752
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.