DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and lrrc39

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001017760.1 Gene:lrrc39 / 550456 ZFINID:ZDB-GENE-050417-279 Length:343 Species:Danio rerio


Alignment Length:208 Identity:60/208 - (28%)
Similarity:97/208 - (46%) Gaps:16/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVN 258
            |:::.:|...|.|:..|.|..|.:..:|.....:|  ||..|.:|.|::|.:|. |......|..
Zfish   100 LQRIPRFISSFQSLIVLDLSRNSVTEIPKEIGKLT--RLRELLLSYNRVSYVPE-ELGCCENLEK 161

  Fly   259 LSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVAT 323
            |.||.|...|.:...|.|..||..|.|:.|:...:| .||.|.|.||.|.:..|:|:.||:::..
Zfish   162 LELAMNQDLDELPTQLSNLKKLSHLDLSMNQFTTIP-DCVVNLPSLEWLDMGSNILETLPDDIHR 225

  Fly   324 LGQLRVLRCCNNLLLCTP-QLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGN------ 381
            :.:|..|....|.|...| .::::..|..|.||.|.|..:..| :....||::::...|      
Zfish   226 MEKLHTLWLPRNELEYLPDNISRMKSLDTLVLSKNKLRDIPPL-MEGMSNLRFVNFRDNPLTYDV 289

  Fly   382 ----LQLQVDEQQ 390
                |...|:|::
Zfish   290 TLPDLNEDVEEEE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380 4/14 (29%)
LRR_8 205..266 CDD:290566 19/60 (32%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 7/22 (32%)
LRR_RI <256..410 CDD:238064 43/146 (29%)
leucine-rich repeat 256..276 CDD:275380 7/19 (37%)
LRR_8 279..359 CDD:290566 27/80 (34%)
leucine-rich repeat 280..303 CDD:275380 8/22 (36%)
leucine-rich repeat 304..348 CDD:275380 12/44 (27%)
leucine-rich repeat 349..372 CDD:275380 7/22 (32%)
PP2Cc 461..655 CDD:294085
lrrc39NP_001017760.1 LRR 1. /evidence=ECO:0000255 64..87
LRR 2. /evidence=ECO:0000255 88..110 2/9 (22%)
leucine-rich repeat 91..108 CDD:275380 2/7 (29%)
LRR_RI 99..>286 CDD:238064 57/190 (30%)
LRR 3. /evidence=ECO:0000255 111..133 5/21 (24%)
leucine-rich repeat 113..135 CDD:275380 5/23 (22%)
LRR 4. /evidence=ECO:0000255 134..156 9/24 (38%)
leucine-rich repeat 136..158 CDD:275380 7/22 (32%)
LRR_8 158..214 CDD:290566 21/56 (38%)
LRR 5. /evidence=ECO:0000255 158..180 7/21 (33%)
leucine-rich repeat 159..182 CDD:275380 8/22 (36%)
LRR 6. /evidence=ECO:0000255 181..203 8/22 (36%)
leucine-rich repeat 183..205 CDD:275380 8/22 (36%)
LRR 7. /evidence=ECO:0000255 204..226 8/21 (38%)
leucine-rich repeat 206..228 CDD:275380 7/21 (33%)
LRR_8 228..285 CDD:290566 15/57 (26%)
LRR 8. /evidence=ECO:0000255 228..249 5/20 (25%)
leucine-rich repeat 229..251 CDD:275380 5/21 (24%)
LRR 9. /evidence=ECO:0000255 250..274 7/24 (29%)
leucine-rich repeat 252..274 CDD:275380 7/22 (32%)
LRR 10. /evidence=ECO:0000255 275..295 2/19 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45752
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.