DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and ACXB

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster


Alignment Length:483 Identity:92/483 - (19%)
Similarity:155/483 - (32%) Gaps:173/483 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 NDSIFEPLHNAAKLRV---LHLAYNRIGVLPAACVRNWPELEILVLSGNML--------QQLPEE 320
            ::.|.|.:|:...:.|   .:|.:|.:|:.            ..:::..|:        |.|.||
  Fly   191 DEDISEVVHDLDTICVDIFHYLGFNLMGIF------------FRIMNDTMVRSSFLDRHQFLKEE 243

  Fly   321 VATLGQLRVLRCCNNLLL---CTPQLAKLAMLKVLD---LSHNHLDRV--------NLLALV--P 369
            :    .||..|...::||   ..||:||.....:.:   ||....||:        |.:|:.  |
  Fly   244 M----WLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVNARRTENFMAIQIHP 304

  Fly   370 SRNLKYLDLSGNLQLQVD---EQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQRNQNK 431
            ..::.|.|:.....|...   |:..||          |.|:.|....|..|.|::::..      
  Fly   305 DVSILYADVVNYTHLTTTLTVEKLVKV----------LHDLYGRFDMAASTFKVQRIKF------ 353

  Fly   432 TSGPWTMGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALEGRGRAAQEMSHLVPDLMKQ 496
                          .|||                       :..:.|.|.|..:.:.:...|   
  Fly   354 --------------LGDC-----------------------YYCVAGLGEADPDHARMAVSL--- 378

  Fly   497 EQMVKDSAVRDYMKFTLLAAQQQCGSVRSAALFHLTRTRAPSKVRPLKSKRYVLRM-ASTGGLDA 560
                         ..:::|..|:                    ||..::....:|: ..:|.|.|
  Fly   379 -------------GISMIANIQE--------------------VRAHRALDIDMRIGVHSGTLLA 410

  Fly   561 YLIRRTS-QLRLTKPDVIQKDQIHSMPDP---HVLELILS--NDDEYLVVGNAQLWSVMDIDRAA 619
            .:|.:.. |..:..|||...:::.:...|   ||....||  |..||.|....:   |...|...
  Fly   411 GVIGQAKLQYDIWGPDVDIANRLEATGKPGYVHVSGRTLSSLNVAEYTVFPGTE---VAQSDPIL 472

  Fly   620 REIRKEENSLLAAK-----RLVDIAQSFAAAESLSVIVVRFRHLGTD-VDHLIR------ELKQS 672
            ::.......|.||.     |.||...|:|.        :....||.. ...::|      ||::.
  Fly   473 QKQPMTTYLLTAAPSRNSVRSVDAVHSYAE--------IDINALGASRKSPILRPTLMSDELREE 529

  Fly   673 VRKKPQPVSLPLSSGSVCKRTCC-DRSN 699
            .:|.|       ..|...:..|| |.||
  Fly   530 FKKMP-------VGGFNIRSPCCRDNSN 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064 36/172 (21%)
leucine-rich repeat 256..276 CDD:275380 2/8 (25%)
LRR_8 279..359 CDD:290566 20/96 (21%)
leucine-rich repeat 280..303 CDD:275380 4/25 (16%)
leucine-rich repeat 304..348 CDD:275380 14/54 (26%)
leucine-rich repeat 349..372 CDD:275380 7/35 (20%)
PP2Cc 461..655 CDD:294085 36/205 (18%)
ACXBNP_620474.2 AC_N <36..276 CDD:292831 21/100 (21%)
CYCc 249..459 CDD:214485 54/298 (18%)
Nucleotidyl_cyc_III 298..484 CDD:299850 46/277 (17%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.