DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and ACXE

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster


Alignment Length:279 Identity:58/279 - (20%)
Similarity:103/279 - (36%) Gaps:56/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NEMEVLDLSSLAQLETLKCSRNKLMEL-IINGTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDI 141
            |...:|.||.:          |.:||: .|:|.::...:..|:............:...:..:|:
  Fly   365 NNCVILGLSMI----------NHIMEVRDIHGLDINMRIGVHSGNLFAGVIGEAKLQFDIWGLDV 419

  Fly   142 SHNNFSELPNWVGACASLTAINASHNRLNNVAV----------------LLRNYRI-TELVSLDL 189
            :..|..| ...|..|     ::.|...|||:.|                ||:.||| :.::..||
  Fly   420 TIANVLE-STGVPGC-----VHISGATLNNLDVNRFDIEDGPEEARDHPLLKKYRIRSYIIRQDL 478

  Fly   190 AYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPD----NFFAVTHARL----ETLNVSC---NKLS 243
            ..:| :..|:|.....||....:.:.  |.:.|    :..|:.|..|    ..:.||.   .:|.
  Fly   479 HMDD-EDSDEFLGDLHSISLCNMGAQ--PRISDSANQSLRALFHEELREEFRKMPVSAFSPKRLL 540

  Fly   244 TLPRYEQNNHA-ALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAA--CVRNWPELE 305
            .:.|:...... |..||::.     .:..:|:...|.|:.....|....:|.|:  |...:.||.
  Fly   541 GICRFNTGKEVPAHQNLNIC-----LTFTDPILERAYLKQTDYMYKYSIILSASVGCSLVYIELM 600

  Fly   306 ILVLSGNMLQQLPEEVATL 324
            ...:..:....||..|||:
  Fly   601 DTQMICSSCFVLPASVATI 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/19 (26%)
LRR_8 109..169 CDD:290566 7/59 (12%)
leucine-rich repeat 111..135 CDD:275380 1/23 (4%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 10/40 (25%)
leucine-rich repeat 184..209 CDD:275380 7/24 (29%)
LRR_8 205..266 CDD:290566 14/72 (19%)
leucine-rich repeat 210..230 CDD:275380 3/23 (13%)
leucine-rich repeat 232..255 CDD:275380 5/30 (17%)
LRR_RI <256..410 CDD:238064 16/71 (23%)
leucine-rich repeat 256..276 CDD:275380 3/19 (16%)
LRR_8 279..359 CDD:290566 12/48 (25%)
leucine-rich repeat 280..303 CDD:275380 5/24 (21%)
leucine-rich repeat 304..348 CDD:275380 6/21 (29%)
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147 20/109 (18%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.