DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Phlpp and NPR3

DIOPT Version :9

Sequence 1:	NP_001260558.1	Gene:	Phlpp / 35178	FlyBaseID:	FBgn0032749	Length:	954	Species:	Drosophila melanogaster
Sequence 2:	NP_001191304.1	Gene:	NPR3 / 4883	HGNCID:	7945	Length:	541	Species:	Homo sapiens

Alignment Length:	200	Identity:	44/200 - (22%)
Similarity:	63/200 - (31%)	Gaps:	70/200 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly   478 GRGRAAQEMSHLVPDLMKQEQMVKDSAVRDYMKFTLLAAQQQCGSVRSAALFHLTRTRAPSKVRP 542
            |.|...||...|.|                 .|..:|....|..|.    ||.|||      |||
Human    37 GIGGGRQEREALPP-----------------QKIEVLVLLPQDDSY----LFSLTR------VRP 74

  Fly   543 LKSKRYVLRMASTGGLDAYLIRRTSQLRLTKPDVIQKDQIHSMPDPHVLELILSNDDEYLVVGNA 607
              :..|.||.....|....|:...::.::...|                     :|     .||.
Human    75 --AIEYALRSVEGNGTGRRLLPPGTRFQVAYED---------------------SD-----CGNR 111

  Fly   608 QLWSVMDIDRAAREIRKE-------ENSLLAAKRLV---DIAQSFAAAESLSVIVVRFRHLGTDV 662
            .|:|::|...|||..:.:       |.:.....||.   |:....|.|     :...|:|..::.
Human   112 ALFSLVDRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGA-----LAAGFQHKDSEY 171

  Fly   663 DHLIR 667
            .||.|
Human   172 SHLTR 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Phlpp	NP_001260558.1	leucine-rich repeat	91..110	CDD:275380
		LRR_8	109..169	CDD:290566
		leucine-rich repeat	111..135	CDD:275380
		leucine-rich repeat	136..158	CDD:275380
		leucine-rich repeat	159..183	CDD:275380
		leucine-rich repeat	184..209	CDD:275380
		LRR_8	205..266	CDD:290566
		leucine-rich repeat	210..230	CDD:275380
		leucine-rich repeat	232..255	CDD:275380
		LRR_RI	<256..410	CDD:238064
		leucine-rich repeat	256..276	CDD:275380
		LRR_8	279..359	CDD:290566
		leucine-rich repeat	280..303	CDD:275380
		leucine-rich repeat	304..348	CDD:275380
		leucine-rich repeat	349..372	CDD:275380
		PP2Cc	461..655	CDD:294085	39/186 (21%)
NPR3	NP_001191304.1	PBP1_NPR_C_like	54..446	CDD:107381	36/165 (22%)
		ANF_receptor	71..422	CDD:279440	29/144 (20%)
		TM_EphA1	476..507	CDD:214014
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900