| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_024303324.1 | Gene: | NPR2 / 4882 | HGNCID: | 7944 | Length: | 1103 | Species: | Homo sapiens |
| Alignment Length: | 271 | Identity: | 50/271 - (18%) |
|---|---|---|---|
| Similarity: | 96/271 - (35%) | Gaps: | 92/271 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 AAEEEQAATFGQTSPQKLSLKG-----SQLGGSILIGNYNYLTQLEVCENEME-VLDLSSLAQLE 92
Fly 93 TLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVPLKLQRID-ISHNNFSELPNWVGAC 156
Fly 157 ASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLP 221
Fly 222 DNFFAVTHARLETLNVSCNKLSTLPRYEQNNHA-ALVNLSLAGNHLNDSIFEPLHNAAKLRVLHL 285
Fly 286 AYN----RIGV 292 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 3/18 (17%) |
| LRR_8 | 109..169 | CDD:290566 | 8/60 (13%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | 2/23 (9%) | ||
| leucine-rich repeat | 136..158 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 5/23 (22%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 3/24 (13%) | ||
| LRR_8 | 205..266 | CDD:290566 | 12/61 (20%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 7/23 (30%) | ||
| LRR_RI | <256..410 | CDD:238064 | 10/41 (24%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 4/19 (21%) | ||
| LRR_8 | 279..359 | CDD:290566 | 6/18 (33%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 6/17 (35%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | |||
| leucine-rich repeat | 349..372 | CDD:275380 | |||
| PP2Cc | 461..655 | CDD:294085 | |||
| NPR2 | XP_024303324.1 | Periplasmic_Binding_Protein_Type_1 | 26..421 | CDD:324556 | |
| PK_GC-A_B | 521..848 | CDD:270944 | 6/28 (21%) | ||
| HNOBA | <857..902 | CDD:311573 | 10/67 (15%) | ||
| CYCc | 881..1065 | CDD:214485 | 35/207 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||