DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AgaP_AGAP009315

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_001230685.2 Gene:AgaP_AGAP009315 / 4578014 VectorBaseID:AGAP009315 Length:1157 Species:Anopheles gambiae


Alignment Length:517 Identity:94/517 - (18%)
Similarity:171/517 - (33%) Gaps:181/517 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KSKLKVSASHSGPHPLPVEVTAAEEEQAATFGQTSPQKLSLKGSQLGGSILIGNY--NYLTQLEV 75
            |...|::|||.  .||.:.:|      ..:|..|..:..|:        .|..:|  ||...:  
Mosquito   711 KKSCKLAASHR--TPLSLNIT------NVSFASTEMEPASV--------CLFPSYFSNYTVLI-- 757

  Fly    76 CENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLH-----------NISTTNT 129
                  ::..|.:.||..|    :|::.:||       :.|.|.|::           :....|.
Mosquito   758 ------LIATSIITQLSHL----SKILLMII-------ITAIHCYVNIFHLDEAFRNEDFGIMNV 805

  Fly   130 HPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDL 194
            .|:...|..:            .|....:|:.:....::::.|..:.:    ||::......:|:
Mosquito   806 FPLRYTLSAL------------LVAVTIALSFLARHIDKVDRVIFMWK----TEVIDQKEKASDM 854

  Fly   195 KQLDQFPEGFSSIRSLQLQSNELP------------SLPDNFFAVTHARLETLNVSCNKLSTLPR 247
            ::           |:..|..|.||            ...|:.::.::|.:..|..|....|....
Mosquito   855 RR-----------RNEALVYNVLPMHVAEHFMGNRKRSHDDLYSQSYAEVGVLFASMPNFSDFYS 908

  Fly   248 YEQNNHAALVNLSLAGNHLNDSIFEPL------HNAAKLRVLHLAYNRI-GVLPAACVR------ 299
            .|..|:..|..|......::|  |:.|      .:..|::.:...|... |:.|:..|:      
Mosquito   909 EETVNNQGLECLRFLNEVISD--FDALLELPQFQDIIKIKTIGSTYMAASGLNPSRIVKPDDPVS 971

  Fly   300 -NWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNH----- 358
             .|..|.:||           |.|.                  :|.| |:..:.:.|.||     
Mosquito   972 VRWAHLALLV-----------EFAL------------------ELKK-ALQGINEQSFNHFVLKM 1006

  Fly   359 -LDRVNLLALVPSRNLKYLDLSGNL--------------QLQVDEQQFKVCQ----SQSQRHWSL 404
             ::...:.|.|......:.|:.||.              .:||.|:..::.|    :..||  .|
Mosquito  1007 GVNHGPITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTEETCQILQTFGYTFEQR--GL 1069

  Fly   405 VDVSGNN------------RAALPTTK--IRQVSAQR-----NQNKTSGPWTMGFAETPGSG 447
            |.|.|..            |...||..  ::.::|..     :::|.|.|   ..|..||.|
Mosquito  1070 VAVKGKGQLMTYYLQGKVPRPTGPTASPILQNLTAMETVQEVDESKESPP---ALAPPPGDG 1128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/18 (28%)
LRR_8 109..169 CDD:290566 8/70 (11%)
leucine-rich repeat 111..135 CDD:275380 5/34 (15%)
leucine-rich repeat 136..158 CDD:275380 2/21 (10%)
leucine-rich repeat 159..183 CDD:275380 2/23 (9%)
leucine-rich repeat 184..209 CDD:275380 1/24 (4%)
LRR_8 205..266 CDD:290566 14/72 (19%)
leucine-rich repeat 210..230 CDD:275380 5/31 (16%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
LRR_RI <256..410 CDD:238064 36/191 (19%)
leucine-rich repeat 256..276 CDD:275380 5/25 (20%)
LRR_8 279..359 CDD:290566 17/93 (18%)
leucine-rich repeat 280..303 CDD:275380 5/30 (17%)
leucine-rich repeat 304..348 CDD:275380 7/43 (16%)
leucine-rich repeat 349..372 CDD:275380 5/28 (18%)
PP2Cc 461..655 CDD:294085
AgaP_AGAP009315XP_001230685.2 AC_N <49..284 CDD:292831
CYCc 250..447 CDD:214485
Guanylate_cyc 288..470 CDD:278633
CYCc 853..1065 CDD:214485 44/254 (17%)
Guanylate_cyc 885..1085 CDD:278633 43/233 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.