DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Adcy1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_033752.1 Gene:Adcy1 / 432530 MGIID:99677 Length:1118 Species:Mus musculus


Alignment Length:192 Identity:41/192 - (21%)
Similarity:58/192 - (30%) Gaps:83/192 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   726 LAKDKDDEFVLAHARVLQEEQQLEMLDETESVSESV---------LSEEQFKC-------WEYML 774
            |.:.|.|.   ||..|   |..|:|:|...||:|:.         |...:..|       |:|.:
Mouse   359 LTQPKTDH---AHCCV---EMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDV 417

  Fly   775 EQNTQLLFDKELNTISKSFTKQRTVPNAIMAATVLPERNDFTSNLMRTVTNKFISTSTPQLPQPI 839
            ..|...|.:                   :|.|..||.:...|.                      
Mouse   418 WSNDVTLAN-------------------VMEAAGLPGKVHITK---------------------- 441

  Fly   840 TTSVPLGSYHQVKQAPPGHFGSALSFQQAHSY---------------GYNLFDAKP--RPKF 884
            ||...|...::|:   |||.....:|.:.|:.               |..|.|.||  |.||
Mouse   442 TTLACLNGDYEVE---PGHGHERNTFLRTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKF 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
Adcy1NP_033752.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
AC_N <158..291 CDD:292831
CYCc 257..452 CDD:214485 27/139 (19%)
Guanylate_cyc 293..475 CDD:278633 33/165 (20%)
Interaction with calmodulin. /evidence=ECO:0000250 492..519 5/9 (56%)
CYCc 825..1036 CDD:214485
Guanylate_cyc 858..1055 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 1023..1046
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1079..1118
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.