DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Gyc89Db

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster


Alignment Length:358 Identity:68/358 - (18%)
Similarity:131/358 - (36%) Gaps:89/358 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 RVNLLALVPSRNLKYLDLSGNLQL----QVDEQQFKVCQSQSQ--RHWSLVDVSGNNRAALPTTK 419
            |||::|......:..:||:..|:|    .|.:...|:..:..:  ..|.|.:...|.:..:.:..
  Fly   205 RVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMKITLAGEKIVETWILHNPGVNPKTFIGSHI 269

  Fly   420 IRQVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALE-GRGRAA 483
            :.:...:|.:: |...|     ||          :.|:|...:         .||.:. |..|||
  Fly   270 LERFKCRRPKD-TQIQW-----ET----------ILQMRTVLF---------EFELIRTGHNRAA 309

  Fly   484 QEMSHLVPDLMKQEQMVKDSAVRDYMKFTLLAAQQQCGSVRSAALFHLTRTRAPSKVRPLKSKR- 547
            .:.: |..|.   |...:.|::.:.....|.:|::  .|..:|.........:..::.|...:| 
  Fly   310 YDAA-LNFDF---ENFDEASSLNEAQAMALASAKE--FSAENAKEEAAAAATSKDEIDPATGQRR 368

  Fly   548 --YVLRMASTGGLDAYLIRRTSQLRLTKPDVIQKDQIHSMP------DPHVL--ELILSN----- 597
              ..||.....|...|:....|.:.|..|.:...|::|.:.      :||.|  ||:::.     
  Fly   369 HSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCS 433

  Fly   598 ----------------------DDEYLVVGNAQLWSVMDIDRAAREIRKEENSLLAAKRLVDIAQ 640
                                  .|.:...|:..|:|::....|.|..:.||:          :.|
  Fly   434 KLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEH----------VCQ 488

  Fly   641 SFAAAESLSVIVVRFRHLGTDVDHLIRELKQSV 673
            ||   |.:|||.:...::.....:.|::..|:|
  Fly   489 SF---EEVSVIFIEVMNIYDSGSNNIQDAMQAV 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064 12/54 (22%)
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380 4/10 (40%)
PP2Cc 461..655 CDD:294085 45/232 (19%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 51/291 (18%)
Nucleotidyl_cyc_III 488..665 CDD:416391 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.