DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Gyc89Da

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:395 Identity:72/395 - (18%)
Similarity:128/395 - (32%) Gaps:143/395 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 LVPSRNLKYLDLSG-----------------NLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAA 414
            ::.|:|    |:||                 ..:|..|.:::...:..::.|.|        :..
  Fly   164 VIESQN----DISGGTAGPIKLTDGPLTVIVKYRLDFDNREYMAKRVNTEAHPS--------QLK 216

  Fly   415 LPTTKI--------------RQVSAQRNQNKTSGPWTMGFAETPGSG-------------DCRKL 452
            :||.|:              ..:.......|....|.|   ..||:.             .||:.
  Fly   217 MPTVKLDVFLDLFPFTFVLNHDMKITHAGEKIVETWIM---HNPGANPKSFIGTHVMDLFQCRRP 278

  Fly   453 --------SVYQLRAANYGGSDEALYGMFEALE-GRGRAAQEMSHLVPDLMKQEQMVKDSAVRDY 508
                    ::.|:||..:         .||.:. |..|||.: :.|..|....::|..:.|    
  Fly   279 KDTTIDWDTLIQMRAVLF---------EFELIRTGHNRAAYD-AVLNMDFENYDEMDLNEA---- 329

  Fly   509 MKFTLLAAQQQCGSVRSAALFHLT---RTRAPSKVRPLKSKRYVLRMASTGGLDAYLIRR----- 565
            ....|..||:...|       |..   .:....::.|...:|     .|:.||.:.|::.     
  Fly   330 QTMALAKAQEFSES-------HPVDDDESAREDEIDPATGER-----RSSQGLRSILLKGQMFYI 382

  Fly   566 ---TSQLRLTKPDVIQKDQIHSMP------DPHVLELILSNDDEYLVVGNAQLWSVMDIDRAARE 621
               .|.:.|..|.:...|::|.:.      :||.|       ...||:...|..|.::|     .
  Fly   383 KDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL-------SRELVMAGWQHCSKLEI-----M 435

  Fly   622 IRKEENSLLAAKRLVDIAQSFAAAESLSVIVVRFRHLGTDVDHLIRELKQSVRKKPQPVSLPLSS 686
            ..|||      :|..::.:|...|:|       ::..|.       ||..|:..:|....:.||.
  Fly   436 FEKEE------QRSDELEKSLELADS-------WKRQGD-------ELLYSMIPRPIAERMRLSE 480

  Fly   687 GSVCK 691
            ..||:
  Fly   481 EQVCQ 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064 9/59 (15%)
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380 1/4 (25%)
PP2Cc 461..655 CDD:294085 41/211 (19%)
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 59/318 (19%)
CYCc 457..643 CDD:214485 9/36 (25%)
Guanylate_cyc 485..662 CDD:278633 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.