DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and CG14877

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:255 Identity:55/255 - (21%)
Similarity:97/255 - (38%) Gaps:65/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 LILSNDDEYLVVGNAQLWSVMDIDRAA-REIRKEENSLLAAKRLVD---IAQSFAAAESLSVIVV 653
            ::|.:|:.|    .|.|..|:.|.:.| ::||.:  ||:.:.  :|   :|.......||.||..
  Fly    46 VLLPDDNMY----QASLPRVLPILKVAEQQIRSK--SLIPSH--IDFEWLAHDTKCDASLGVIKA 102

  Fly   654 RFRHLGTDVDHLIRELKQSVRKKPQPVSLPLSSGSVCKRTCCDRSNACRHRAIEQEPLAGRSSPS 718
                    :|.:|::..|.:            .|.||..:....|...::...:..||..    .
  Fly   103 --------MDGIIKQCAQVI------------FGPVCDYSLAAVSRITKYFNSQGTPLIS----V 143

  Fly   719 GQSDRDLLAK--DKDDEF-VLAHARVLQEEQQLEMLDETESVSESVLSEEQFKCWEYMLEQNTQL 780
            |.|..|...|  |.:||| :|....:|          ..|::||..::..:...|.:.:     .
  Fly   144 GGSTYDFEQKKTDCNDEFYMLLRTGML----------SFETISELTINVMKRHNWSHSI-----F 193

  Fly   781 LFDKE-------LNT---ISKSFTKQRTVPNAIMAATVL-PERNDFTSNLMRTVTNKFIS 829
            .::::       ::|   :.||..||....|...|...| |...:.|..:.|.:.||..|
  Fly   194 YYERDGQRSVAGMHTCFLMMKSLGKQMRNENMTFAQFPLEPNLTNRTEEMRREIGNKHAS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085 18/65 (28%)
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 50/241 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.