DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and CG31183

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:449 Identity:88/449 - (19%)
Similarity:151/449 - (33%) Gaps:107/449 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   433 SGPWTMGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALEGRGRAAQEMSHLVPDLMKQE 497
            |..|   |.:....|....:.|         ||||..:...|........:.|:....|.|...:
  Fly    24 SAAW---FYDAESVGGVASIGV---------GSDEHSFKTPETKNSHKSQSTELVQHFPSLPMPD 76

  Fly   498 QMVKDSAVRDYMKFTLLAAQQQCGSVRSAALFHLTRTRAPSKVRPL--KSKRYVLRMASTGG--L 558
            .  :....|..:.|..|....:..:.....:         .||.|:  .:.|:|.||...||  .
  Fly    77 H--RRLGARRQLVFVALLPSVESDNKNDCIM---------PKVLPVLELAIRHVQRMGFVGGSHF 130

  Fly   559 DAYLIRRTS------------QLRLTKPDVIQKDQIHSMPDPHVLELILSNDDEYLVVGNAQLWS 611
            |..||.|.:            ::....|:|   :.:..:|    .|.:|:....|     |.:|.
  Fly   131 DIQLISRDTFCSSKYGPIGFFEIYTQWPEV---NAVFGLP----CEYVLAPISRY-----ADVWQ 183

  Fly   612 --VMDIDRAAREIRKEENSLLAAKRLVDIAQSFAAAESLSVIVVRFRHLGTDVDHL---IRELKQ 671
              |:.....|:|..|:..|.....||                      .|..|::|   :|.:..
  Fly   184 VPVLTTGGNAKEFNKKSESYSTLTRL----------------------KGAQVNNLGNVVRAILN 226

  Fly   672 SVRKKPQPVSLPLSSGSVCKRTCCDRSNACRHRAIEQE---PLAGRSSPSGQSDRDLLAKD--KD 731
            |.......:.....:..|...:.|....|..|..||:.   .|...:|...::|...:.|:  ..
  Fly   227 SFNWTRTALIYQNENAKVKGNSVCFLCLAAIHDTIEEHSVYQLGFDTSTWTKADITRMLKNVAMQ 291

  Fly   732 DEFVLAHA------RVLQEEQQLEMLDETESVSESVLSEEQFKCWEYMLEQNTQLLFDKELNT-- 788
            ...|:..|      :::...::|.|:|..|.|   .::.|.|...:|:..|......|.:||.  
  Fly   292 SRIVIMCADPQSIRQIMLTAEELNMIDSGEYV---FINIELFSRVQYLTSQPWYDKNDTDLNNER 353

  Fly   789 ISKSFTKQRTV-PNAIMAATVLPERNDFT--SNLMRTV-TNKFISTSTPQLPQPITTSV 843
            ..|::|...|| |..       |..|::|  ||.::.: ..|:..|.:..  :||:..|
  Fly   354 AQKAYTAMLTVTPKQ-------PNDNEYTRVSNEIKAIAAEKYNYTFSDN--EPISAFV 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085 39/211 (18%)
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368 74/371 (20%)
ANF_receptor 108..473 CDD:279440 71/342 (21%)
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003
CYCc 917..1108 CDD:214485
Guanylate_cyc 944..1130 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.