DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and CG6959

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001138037.1 Gene:CG6959 / 41434 FlyBaseID:FBgn0037956 Length:425 Species:Drosophila melanogaster


Alignment Length:410 Identity:102/410 - (24%)
Similarity:147/410 - (35%) Gaps:130/410 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 ISHNNFSELPNWVGACA---------SLTAINASHNRLNNVAVL-----------LRNYRITELV 185
            :..|:.|..||:..||:         ....:|.::..|.|.:||           ....|||||.
  Fly    20 LGENSSSCGPNFPAACSCGQEMYESEMQYVVNCTNAGLVNTSVLEFMPEQVEVLIFTGNRITELP 84

  Fly   186 -SLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTH--ARLETLNVSCNKLSTLPR 247
             ::..:.|:.|||          |.:.:.||.:..:....:   |  .|:|.|.::.|.|| :.|
  Fly    85 WNVFGSINNYKQL----------RIVDMSSNHIREIRGKSY---HHVPRVERLILNHNNLS-ISR 135

  Fly   248 YEQ--NNHAALV---NLSLAGNHLNDS--------IFEPLHN------AAKLRVLHLAYNRIGVL 293
            ||.  |:|...|   .::|...||.|:        :.|.||:      ..||:.|||..|.|...
  Fly   136 YEDEVNHHHPRVFSNFINLQSLHLTDAFEDNSSPQLSEDLHDIFVNSQLVKLQKLHLEQNEITHF 200

  Fly   294 P---AACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLS 355
            .   ..|  :.|.|..|.|..|.|:.|..||         ||.|||.....:..|.:.:|..|| 
  Fly   201 KDRNVFC--DLPSLRDLHLGDNDLRDLNFEV---------RCLNNLRFLDLERNKFSFVKPTDL- 253

  Fly   356 HNHLDRV-NLLALVPSRNLKYLDLSGNLQLQVDEQQFKV-CQSQSQRHWSLVDVSGNNRAALPTT 418
                 || |.|...|:|       :.||.:..:...|.. |::...|.|            :.||
  Fly   254 -----RVLNELEERPNR-------TANLIVDFNLNPFGCDCRTAPFRAW------------ITTT 294

  Fly   419 KIRQVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSVYQLRAANYG------------GSDEALYG 471
            ::..      :||.|   .|.|..| |..|.....:.|:......            ..||..||
  Fly   295 RVTV------RNKDS---LMCFHST-GHVDAEPAHLLQMDMGQCADAIAAAATILNTAEDEPHYG 349

  Fly   472 MFEALEGRGRAAQEMSHLVP 491
            ..||           |||.|
  Fly   350 DPEA-----------SHLQP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 7/36 (19%)
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380 6/25 (24%)
leucine-rich repeat 159..183 CDD:275380 7/34 (21%)
leucine-rich repeat 184..209 CDD:275380 5/25 (20%)
LRR_8 205..266 CDD:290566 17/67 (25%)
leucine-rich repeat 210..230 CDD:275380 3/21 (14%)
leucine-rich repeat 232..255 CDD:275380 10/24 (42%)
LRR_RI <256..410 CDD:238064 46/175 (26%)
leucine-rich repeat 256..276 CDD:275380 7/30 (23%)
LRR_8 279..359 CDD:290566 26/82 (32%)
leucine-rich repeat 280..303 CDD:275380 7/25 (28%)
leucine-rich repeat 304..348 CDD:275380 14/43 (33%)
leucine-rich repeat 349..372 CDD:275380 8/23 (35%)
PP2Cc 461..655 CDD:294085 10/43 (23%)
CG6959NP_001138037.1 leucine-rich repeat 70..96 CDD:275380 6/25 (24%)
LRR_8 95..161 CDD:290566 22/79 (28%)
leucine-rich repeat 97..120 CDD:275380 5/35 (14%)
LRR_RI <116..>224 CDD:238064 34/110 (31%)
leucine-rich repeat 121..153 CDD:275380 11/32 (34%)
leucine-rich repeat 154..186 CDD:275380 7/31 (23%)
LRR_8 186..245 CDD:290566 22/69 (32%)
leucine-rich repeat 187..211 CDD:275380 7/25 (28%)
leucine-rich repeat 212..234 CDD:275380 10/30 (33%)
leucine-rich repeat 235..258 CDD:275380 7/28 (25%)
TPKR_C2 276..328 CDD:301599 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.