DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and caps

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster


Alignment Length:397 Identity:96/397 - (24%)
Similarity:156/397 - (39%) Gaps:80/397 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LTQLEVCENEMEVLDLSS--LAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPV 132
            :.:|.:..|:::.:|.|.  .|||..|..|.|.::           .:.:.::.::         
  Fly    74 IQRLVIKNNKLKTIDSSMQFYAQLTFLDLSFNDML-----------TIPERSFAYH--------- 118

  Fly   133 PLKLQRIDISHNNFSELPN--WVGACASLTAINASHNRLNNVAVLLRNYR----ITELVSLDLAY 191
             .|||.:.:.||...::.|  ::|    |:.|:..:.|.|.:|.|  .||    :.:|..|:|..
  Fly   119 -AKLQELHLDHNKIGQVSNKTFLG----LSTISVLNLRGNLIAEL--EYRTFSPMVKLAELNLGQ 176

  Fly   192 NDLKQLDQFP-EGFSSIRSLQLQSNELPSLPDNF-FAVTHARLETLNVSCNKLSTLPRYEQNNHA 254
            |.:..:|... :|..::|.|.|..|.|.::|... |...|: |..|.:..|...|:|.....:..
  Fly   177 NRISHIDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHS-LAELYLGTNSFMTIPGGAFQDLK 240

  Fly   255 ALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPE 319
            .|..|.|.|..|::...:.|.....||.|.|:.||:..:|.|..:....||.|.:..|..     
  Fly   241 GLTRLDLRGAGLHNISGDALKGLVSLRFLDLSDNRLPAIPTAAFQRLGRLEQLNIGQNDF----- 300

  Fly   320 EVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQL 384
            ||.:.|....||...:|.|...|               .|.||...|...:.||::|:||.|.||
  Fly   301 EVISSGAFSGLRELRHLELTGAQ---------------RLRRVESGAFSGNTNLEHLNLSSNKQL 350

  Fly   385 QVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQRNQNKTSGPW----TMGFAETPG 445
                .:..........|.|.|.:..|..::|....:              ||    |:..:|.|.
  Fly   351 ----NELSSIALGGLPHLSTVVLKANQLSSLDEGLV--------------PWADLQTLDLSENPF 397

  Fly   446 SGDCRKL 452
            ..|||.|
  Fly   398 ECDCRLL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 4/18 (22%)
LRR_8 109..169 CDD:290566 9/61 (15%)
leucine-rich repeat 111..135 CDD:275380 0/23 (0%)
leucine-rich repeat 136..158 CDD:275380 6/23 (26%)
leucine-rich repeat 159..183 CDD:275380 8/27 (30%)
leucine-rich repeat 184..209 CDD:275380 6/25 (24%)
LRR_8 205..266 CDD:290566 17/61 (28%)
leucine-rich repeat 210..230 CDD:275380 6/20 (30%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
LRR_RI <256..410 CDD:238064 41/153 (27%)
leucine-rich repeat 256..276 CDD:275380 6/19 (32%)
LRR_8 279..359 CDD:290566 20/79 (25%)
leucine-rich repeat 280..303 CDD:275380 8/22 (36%)
leucine-rich repeat 304..348 CDD:275380 12/43 (28%)
leucine-rich repeat 349..372 CDD:275380 4/22 (18%)
PP2Cc 461..655 CDD:294085
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 4/20 (20%)
LRR_8 96..155 CDD:290566 16/83 (19%)
leucine-rich repeat 97..120 CDD:275380 4/43 (9%)
leucine-rich repeat 121..144 CDD:275380 7/26 (27%)
LRR_8 143..201 CDD:290566 16/59 (27%)
leucine-rich repeat 145..168 CDD:275380 7/24 (29%)
LRR_RI 147..397 CDD:238064 72/290 (25%)
leucine-rich repeat 169..192 CDD:275380 6/22 (27%)
leucine-rich repeat 193..217 CDD:275380 7/23 (30%)
LRR_8 217..276 CDD:290566 16/59 (27%)
leucine-rich repeat 218..241 CDD:275380 5/22 (23%)
leucine-rich repeat 242..265 CDD:275380 6/22 (27%)
LRR_8 265..321 CDD:290566 19/60 (32%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 8/27 (30%)
LRR_8 312..374 CDD:290566 20/80 (25%)
leucine-rich repeat 314..335 CDD:275380 7/35 (20%)
leucine-rich repeat 339..363 CDD:275380 7/27 (26%)
LRRCT 395..445 CDD:214507 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.