| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_956909.1 | Gene: | lrfn1 / 393587 | ZFINID: | ZDB-GENE-040426-1227 | Length: | 584 | Species: | Danio rerio |
| Alignment Length: | 243 | Identity: | 59/243 - (24%) |
|---|---|---|---|
| Similarity: | 96/243 - (39%) | Gaps: | 94/243 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 68 NYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMEL----------------------IING-- 108
Fly 109 ----TNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINA---SH 166
Fly 167 NRLNNVAV----LLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAV 227
Fly 228 THARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLH 275 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 8/46 (17%) |
| LRR_8 | 109..169 | CDD:290566 | 20/62 (32%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | 5/23 (22%) | ||
| leucine-rich repeat | 136..158 | CDD:275380 | 8/21 (38%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 8/30 (27%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 7/24 (29%) | ||
| LRR_8 | 205..266 | CDD:290566 | 12/60 (20%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 4/22 (18%) | ||
| LRR_RI | <256..410 | CDD:238064 | 6/20 (30%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 279..359 | CDD:290566 | |||
| leucine-rich repeat | 280..303 | CDD:275380 | |||
| leucine-rich repeat | 304..348 | CDD:275380 | |||
| leucine-rich repeat | 349..372 | CDD:275380 | |||
| PP2Cc | 461..655 | CDD:294085 | |||
| lrfn1 | NP_956909.1 | LRR 1 | 52..73 | 2/15 (13%) | |
| LRR_8 | 55..111 | CDD:290566 | 11/56 (20%) | ||
| leucine-rich repeat | 55..76 | CDD:275380 | 3/18 (17%) | ||
| LRR_RI | <71..>208 | CDD:238064 | 40/146 (27%) | ||
| LRR 2 | 76..97 | 8/23 (35%) | |||
| leucine-rich repeat | 77..100 | CDD:275380 | 7/25 (28%) | ||
| LRR_8 | 99..160 | CDD:290566 | 11/60 (18%) | ||
| LRR 3 | 100..121 | 2/20 (10%) | |||
| leucine-rich repeat | 101..124 | CDD:275380 | 2/22 (9%) | ||
| LRR 4 | 124..145 | 6/20 (30%) | |||
| leucine-rich repeat | 125..148 | CDD:275380 | 5/22 (23%) | ||
| LRR 5 | 149..170 | 8/22 (36%) | |||
| leucine-rich repeat | 150..173 | CDD:275380 | 9/24 (38%) | ||
| LRR_8 | 153..208 | CDD:290566 | 23/61 (38%) | ||
| LRR 6 | 173..194 | 5/20 (25%) | |||
| leucine-rich repeat | 174..197 | CDD:275380 | 7/27 (26%) | ||
| LRR 7 | 197..218 | 10/44 (23%) | |||
| leucine-rich repeat | 198..222 | CDD:275380 | 12/47 (26%) | ||
| LRRCT | 241..>270 | CDD:214507 | 4/12 (33%) | ||
| IG_like | 299..375 | CDD:214653 | |||
| Ig_2 | 303..376 | CDD:143241 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 393..414 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 539..564 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X32 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||