DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and CG6749

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_648354.1 Gene:CG6749 / 39144 FlyBaseID:FBgn0036040 Length:552 Species:Drosophila melanogaster


Alignment Length:462 Identity:122/462 - (26%)
Similarity:197/462 - (42%) Gaps:89/462 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KSKLKVSASHSGPH---PLPVEVTAAEEEQAATFGQT---SPQKLSLKGSQLGGSILIGNY---- 67
            :::|:|.:..:..|   .|.:::|.|......|.|.:   :.::|:|.|..|..  :.||:    
  Fly    65 QTELEVGSGENADHLANLLDLDLTGAAPINVHTNGFSILPNLRQLNLSGCGLVD--IRGNHFAPE 127

  Fly    68 NYLTQLEVCENEMEVLD---LSSLAQLETLKCSRNKLMEL-IINGTNLQTLVADHNYLHNISTTN 128
            :.|.:::...|:||:||   ..:|.:|.....|.|.|.:. :.:...|..|...||.|.|.    
  Fly   128 SALQRIDFSHNQMELLDRDFFGNLRKLIYANFSHNALKQCDLPHMPLLNRLELGHNRLVNA---- 188

  Fly   129 THPVPLKLQRIDISHNNFSELP-NWVGACASLTAINASHNRLNNVAVLLRNYR-ITELVSLDLAY 191
            |..|..:||.:.::.|...:|. |.......|..:..|.|||:::.  |..:: :.:|..|:|:.
  Fly   189 TFGVCPQLQELILNDNQLIQLDVNAFRGLHGLLELQLSGNRLSSIG--LETFQPLAQLRKLNLSQ 251

  Fly   192 NDLKQLDQFPEGFSSIRS-------LQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYE 249
            |.|..|.  |..|.::::       |.|..|.:..|.||.|.|. |||:.|:||.|.:::|    
  Fly   252 NALDALR--PNVFGAVQNFVLHLQQLDLSGNRIRLLFDNQFRVL-ARLQMLDVSRNSIASL---- 309

  Fly   250 QNNHAALVNLSLAGNHLNDSIFEPLH--NAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGN 312
                                  .|.|  ....||.|:|.||.|..:..|.......|:.|.||.|
  Fly   310 ----------------------SPAHFVGLGSLRKLYLQYNAILEIKPATFAALLNLDTLDLSYN 352

  Fly   313 MLQQLPEEV---ATLGQLRVLRCCNNLLLCTPQLA--KLAMLKVLDLSHNHLDRVNLLALVPSRN 372
            .|:.|.|::   .||.::|.|....|.:.....||  .|..|:.|.|.||.|..:::....|.|.
  Fly   353 NLEFLEEQIFGGNTLPRMRRLNLNGNRMKHLHPLAFSSLPFLEYLKLGHNELKSLDVRMFAPMRR 417

  Fly   373 LKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNR--------AALPTTKIRQVSAQRNQ 429
            |:.|.|..||   ::|....|.:|.|.....|||   |||        .:.|  .:::|:.:.| 
  Fly   418 LQKLHLGHNL---LEEINLDVLESLSSVQEILVD---NNRLTFLAKVNVSFP--NLKRVAIEGN- 473

  Fly   430 NKTSGPW 436
                 ||
  Fly   474 -----PW 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 4/19 (21%)
LRR_8 109..169 CDD:290566 16/60 (27%)
leucine-rich repeat 111..135 CDD:275380 8/23 (35%)
leucine-rich repeat 136..158 CDD:275380 5/22 (23%)
leucine-rich repeat 159..183 CDD:275380 6/24 (25%)
leucine-rich repeat 184..209 CDD:275380 8/24 (33%)
LRR_8 205..266 CDD:290566 16/67 (24%)
leucine-rich repeat 210..230 CDD:275380 8/19 (42%)
leucine-rich repeat 232..255 CDD:275380 6/22 (27%)
LRR_RI <256..410 CDD:238064 46/160 (29%)
leucine-rich repeat 256..276 CDD:275380 2/21 (10%)
LRR_8 279..359 CDD:290566 29/84 (35%)
leucine-rich repeat 280..303 CDD:275380 8/22 (36%)
leucine-rich repeat 304..348 CDD:275380 16/48 (33%)
leucine-rich repeat 349..372 CDD:275380 7/22 (32%)
PP2Cc 461..655 CDD:294085
CG6749NP_648354.1 LRR_RI 103..>256 CDD:238064 41/160 (26%)
LRR_8 104..164 CDD:290566 16/61 (26%)
leucine-rich repeat 106..129 CDD:275380 6/24 (25%)
leucine-rich repeat 130..153 CDD:275380 7/22 (32%)
leucine-rich repeat 154..195 CDD:275380 12/44 (27%)
LRR_RI 194..455 CDD:238064 84/297 (28%)
LRR_8 194..254 CDD:290566 15/61 (25%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
leucine-rich repeat 220..243 CDD:275380 6/24 (25%)
leucine-rich repeat 244..267 CDD:275380 8/24 (33%)
LRR_8 271..330 CDD:290566 24/85 (28%)
leucine-rich repeat 272..295 CDD:275380 8/23 (35%)
leucine-rich repeat 296..319 CDD:275380 8/48 (17%)
LRR_8 319..380 CDD:290566 21/60 (35%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..369 CDD:275380 10/24 (42%)
LRR_8 368..428 CDD:290566 19/62 (31%)
leucine-rich repeat 370..393 CDD:275380 6/22 (27%)
leucine-rich repeat 394..417 CDD:275380 7/22 (32%)
leucine-rich repeat 418..441 CDD:275380 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.