DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and ACXD

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster


Alignment Length:153 Identity:32/153 - (20%)
Similarity:65/153 - (42%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 FHLTRTRAPSKVRPLKSK-RYVLRMASTGGLDAYLIRRTSQLRLTKPDVIQKDQIHSMPDPHVLE 592
            |:.....:||......:| .::|.|..|.|: .:|:.|.::. :.|.|...|.|:....:    :
  Fly   787 FNFIYANSPSTNVNFNAKYSHILLMIITFGI-FHLMERQTEF-IAKVDYNWKRQLIKKQE----D 845

  Fly   593 LILSNDDEYLVVGNAQLWSVMDI---DRAAREIRKEENSLLAAKRLVDIAQSFAAAESLSVIVVR 654
            .:::||...:::.|.....|.|.   ::...|:..||..        ::|..||:.::.....:.
  Fly   846 ALITNDTIKVLLTNILPTHVADFYLSNQLQNELYYEEYD--------NVAVMFASIKNFDTDKIG 902

  Fly   655 FRHLG---TDVDHLIRELKQSVR 674
            .|.|.   .|.|.::.:..||:|
  Fly   903 LRVLNEIICDFDDVLNKYSQSLR 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085 25/129 (19%)
ACXDNP_620469.2 AC_N <42..284 CDD:292831
CYCc 254..476 CDD:214485
Nucleotidyl_cyc_III 321..503 CDD:299850
CYCc 856..1117 CDD:214485 16/78 (21%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 12/56 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.