DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and CG3494

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster


Alignment Length:213 Identity:56/213 - (26%)
Similarity:94/213 - (44%) Gaps:24/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LRNYRITELVSLDLAYNDLKQLDQFP-EGFSS-----IRSLQLQSNELPSLPDNFFAVTHARLET 234
            :||.||.::        ...|:.:.| |.|.:     :..:.|..|.|..:|.: ..:....|..
  Fly    34 MRNTRILQV--------SKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKD-LPLLSEHLTQ 89

  Fly   235 LNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVR 299
            |.::.|::|.:|. ..:.::.|.||||:.|.|.|...| |.....||.|.:::||...|| .|:.
  Fly    90 LVLNKNQISFVPT-NISQYSKLTNLSLSNNLLCDLPME-LGGLRLLRNLDISHNRFRQLP-RCIY 151

  Fly   300 NWPELEILVLSGNMLQQLPEEVATLGQLRVLRCC----NNLLLCTPQLAKLAMLKVLDLSHN--H 358
            ....||.|....|.::.:....:.||.:|.|:..    |::.:..|.|.|:..|..|:|..|  .
  Fly   152 ELERLETLSAHDNQIRAIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFR 216

  Fly   359 LDRVNLLALVPSRNLKYL 376
            ..|..:|::.....|.||
  Fly   217 QPRHQILSMGTPALLSYL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380 4/6 (67%)
leucine-rich repeat 184..209 CDD:275380 4/30 (13%)
LRR_8 205..266 CDD:290566 15/65 (23%)
leucine-rich repeat 210..230 CDD:275380 4/19 (21%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
LRR_RI <256..410 CDD:238064 39/127 (31%)
leucine-rich repeat 256..276 CDD:275380 10/19 (53%)
LRR_8 279..359 CDD:290566 24/85 (28%)
leucine-rich repeat 280..303 CDD:275380 8/22 (36%)
leucine-rich repeat 304..348 CDD:275380 12/47 (26%)
leucine-rich repeat 349..372 CDD:275380 6/24 (25%)
PP2Cc 461..655 CDD:294085
CG3494NP_611915.1 LRR <34..>231 CDD:227223 53/208 (25%)
leucine-rich repeat 38..62 CDD:275380 6/31 (19%)
leucine-rich repeat 63..86 CDD:275380 4/23 (17%)
LRR_4 85..124 CDD:289563 13/39 (33%)
leucine-rich repeat 87..109 CDD:275380 5/22 (23%)
leucine-rich repeat 110..133 CDD:275380 10/23 (43%)
leucine-rich repeat 134..155 CDD:275380 7/21 (33%)
leucine-rich repeat 156..181 CDD:275380 6/24 (25%)
leucine-rich repeat 182..204 CDD:275380 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.