Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611915.1 | Gene: | CG3494 / 37903 | FlyBaseID: | FBgn0035008 | Length: | 240 | Species: | Drosophila melanogaster |
Alignment Length: | 213 | Identity: | 56/213 - (26%) |
---|---|---|---|
Similarity: | 94/213 - (44%) | Gaps: | 24/213 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 LRNYRITELVSLDLAYNDLKQLDQFP-EGFSS-----IRSLQLQSNELPSLPDNFFAVTHARLET 234
Fly 235 LNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVR 299
Fly 300 NWPELEILVLSGNMLQQLPEEVATLGQLRVLRCC----NNLLLCTPQLAKLAMLKVLDLSHN--H 358
Fly 359 LDRVNLLALVPSRNLKYL 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
LRR_8 | 109..169 | CDD:290566 | |||
leucine-rich repeat | 111..135 | CDD:275380 | |||
leucine-rich repeat | 136..158 | CDD:275380 | |||
leucine-rich repeat | 159..183 | CDD:275380 | 4/6 (67%) | ||
leucine-rich repeat | 184..209 | CDD:275380 | 4/30 (13%) | ||
LRR_8 | 205..266 | CDD:290566 | 15/65 (23%) | ||
leucine-rich repeat | 210..230 | CDD:275380 | 4/19 (21%) | ||
leucine-rich repeat | 232..255 | CDD:275380 | 5/22 (23%) | ||
LRR_RI | <256..410 | CDD:238064 | 39/127 (31%) | ||
leucine-rich repeat | 256..276 | CDD:275380 | 10/19 (53%) | ||
LRR_8 | 279..359 | CDD:290566 | 24/85 (28%) | ||
leucine-rich repeat | 280..303 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 304..348 | CDD:275380 | 12/47 (26%) | ||
leucine-rich repeat | 349..372 | CDD:275380 | 6/24 (25%) | ||
PP2Cc | 461..655 | CDD:294085 | |||
CG3494 | NP_611915.1 | LRR | <34..>231 | CDD:227223 | 53/208 (25%) |
leucine-rich repeat | 38..62 | CDD:275380 | 6/31 (19%) | ||
leucine-rich repeat | 63..86 | CDD:275380 | 4/23 (17%) | ||
LRR_4 | 85..124 | CDD:289563 | 13/39 (33%) | ||
leucine-rich repeat | 87..109 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 110..133 | CDD:275380 | 10/23 (43%) | ||
leucine-rich repeat | 134..155 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 156..181 | CDD:275380 | 6/24 (25%) | ||
leucine-rich repeat | 182..204 | CDD:275380 | 5/21 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45459163 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |