DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and CG10307

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001286690.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster


Alignment Length:370 Identity:84/370 - (22%)
Similarity:154/370 - (41%) Gaps:74/370 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 IDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPE- 202
            :::||...|::|..:..|.:|..:..:.|:|..:...:.:....::::||  ||   :||:||. 
  Fly    28 LNLSHYQISDVPGIIEK
CETLMKLFLNQNKLTKIPSSIGSLMRLQVLTLD--YN---KLDEFPLC 87

  Fly   203 --GFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNH 265
              ....::.|.:..|.:.|||.....:|  :|||...:...|..||. |..|...|..|.:.||.
  Fly    88 ICRLVRLKFLNISCNNISSLPPELGYLT--QLETFWCNNTGLLELPN-EIRNCEHLETLGVRGNP 149

  Fly   266 LNDSIFEPLHNAAKLRVLHLAYNRIGVLP--AACVRNWPELEILVLSGNMLQQLPEEVATLGQLR 328
            |. .:.:.:...:.||.|......:..:|  .|.:.|   |..|.|.||.|::||..:..:.:||
  Fly   150 LK-KLPDAIGALSSLRWLTAEGCELSEVPLTMALLGN---LVHLNLKGNRLRRLPRMLMAMQKLR 210

  Fly   329 VLRCCNNLLLCTP---QLAKLAMLKVLDLSHN----HLDRVNLLALVPSRNLKYLDLSGNLQLQV 386
            ......|.:...|   ||.:|..|.:|:||.|    |.| :.|:||..:          ||.:::
  Fly   211 FAFLNENCIDEMPTRSQLEELRTLHMLNLSKNPISLHRD-LQLMALRQT----------NLYVEL 264

  Fly   387 DEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQ-RNQNKTSGPWTMGFAETPGSGDCR 450
            ......:|...:            :||:|...:.::..|: ..|:..|..|              
  Fly   265 PSDPANICDGLA------------SRASLNAQEQQEDQARGAGQDLDSSDW-------------- 303

  Fly   451 KLSVYQLRAANYGGSDEALYGMFEALEGRGRAAQEMSHLVPDLMK 495
               ...:|.:....:||:      |||..   .:::|.::|::.:
  Fly   304 ---ANSVRTSELDTTDES------ALENN---IEDLSVMLPEMSR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 7/29 (24%)
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380 5/18 (28%)
leucine-rich repeat 159..183 CDD:275380 3/23 (13%)
leucine-rich repeat 184..209 CDD:275380 8/27 (30%)
LRR_8 205..266 CDD:290566 18/60 (30%)
leucine-rich repeat 210..230 CDD:275380 6/19 (32%)
leucine-rich repeat 232..255 CDD:275380 8/22 (36%)
LRR_RI <256..410 CDD:238064 39/162 (24%)
leucine-rich repeat 256..276 CDD:275380 5/19 (26%)
LRR_8 279..359 CDD:290566 26/88 (30%)
leucine-rich repeat 280..303 CDD:275380 6/24 (25%)
leucine-rich repeat 304..348 CDD:275380 15/46 (33%)
leucine-rich repeat 349..372 CDD:275380 10/26 (38%)
PP2Cc 461..655 CDD:294085 7/35 (20%)
CG10307NP_001286690.1 leucine-rich repeat 27..44 CDD:275380 4/15 (27%)
LRR_8 47..104 CDD:290566 13/61 (21%)
leucine-rich repeat 48..70 CDD:275380 3/21 (14%)
LRR 69..>244 CDD:227223 53/186 (28%)
leucine-rich repeat 71..93 CDD:275380 8/26 (31%)
leucine-rich repeat 94..116 CDD:275380 6/23 (26%)
leucine-rich repeat 117..139 CDD:275380 8/22 (36%)
leucine-rich repeat 140..162 CDD:275380 5/22 (23%)
leucine-rich repeat 163..185 CDD:275380 5/21 (24%)
leucine-rich repeat 186..208 CDD:275380 8/21 (38%)
leucine-rich repeat 209..233 CDD:275380 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45752
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.