| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001286627.1 | Gene: | CG11099 / 37282 | FlyBaseID: | FBgn0034485 | Length: | 378 | Species: | Drosophila melanogaster |
| Alignment Length: | 237 | Identity: | 62/237 - (26%) |
|---|---|---|---|
| Similarity: | 93/237 - (39%) | Gaps: | 67/237 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 67 YNYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHP 131
Fly 132 VPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQ 196
Fly 197 LDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCN--------KLSTLPRYEQ--N 251
Fly 252 NHAALVNLSLA----GNHLNDSIFEPLHNAAKLRVLHLAYNR 289 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 4/18 (22%) |
| LRR_8 | 109..169 | CDD:290566 | 18/59 (31%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | 5/23 (22%) | ||
| leucine-rich repeat | 136..158 | CDD:275380 | 8/21 (38%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 3/24 (13%) | ||
| LRR_8 | 205..266 | CDD:290566 | 20/74 (27%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 9/32 (28%) | ||
| LRR_RI | <256..410 | CDD:238064 | 13/38 (34%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 8/23 (35%) | ||
| LRR_8 | 279..359 | CDD:290566 | 2/11 (18%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 2/10 (20%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | |||
| leucine-rich repeat | 349..372 | CDD:275380 | |||
| PP2Cc | 461..655 | CDD:294085 | |||
| CG11099 | NP_001286627.1 | leucine-rich repeat | 4..25 | CDD:275380 | 1/1 (100%) |
| LRR_8 | 26..82 | CDD:290566 | 19/75 (25%) | ||
| leucine-rich repeat | 26..48 | CDD:275380 | 5/22 (23%) | ||
| LRR | <43..>194 | CDD:227223 | 52/201 (26%) | ||
| LRR_4 | 47..87 | CDD:289563 | 16/58 (28%) | ||
| leucine-rich repeat | 49..71 | CDD:275380 | 8/28 (29%) | ||
| leucine-rich repeat | 72..95 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 96..117 | CDD:275380 | 7/35 (20%) | ||
| leucine-rich repeat | 118..140 | CDD:275380 | 6/33 (18%) | ||
| leucine-rich repeat | 141..164 | CDD:275380 | 8/22 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45467253 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||