DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Lap1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001188938.1 Gene:Lap1 / 36670 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster


Alignment Length:774 Identity:171/774 - (22%)
Similarity:285/774 - (36%) Gaps:251/774 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKATRKQADP----YKSKLKVSASHSGPHPLPVEVTAAEEEQAATFGQTSPQKL-SLKGSQ---L 58
            |..||.||.|    |...|:|  .|...:.|                ::.||.: ||:..|   |
  Fly    47 LSTTRLQALPPQLFYCQGLRV--LHVNSNNL----------------ESIPQAIGSLRQLQHLDL 93

  Fly    59 GGSILIGNYNYLTQLEVCENEMEVLDLS--SLAQLETLKCSRNKLMELIINGTNLQTLVADHNYL 121
            ..::::   |...:::.|:: :..||||  ||.:|.....|...|.||::|.|.|:.|.|:...|
  Fly    94 NRNLIV---NVPEEIKSCKH-LTHLDLSCNSLQRLPDAITSLISLQELLLNETYLEFLPANFGRL 154

  Fly   122 HN-----ISTTNTHPVP------LKLQRIDISHNNFSELPNWVGACASLTAI------------- 162
            .|     :...|...:|      :.|||:||..|.|:|||..||...||..:             
  Fly   155 VNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVSAN 219

  Fly   163 ----------NASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSL---QLQS 214
                      .|:.|.|:.:...|.|:|..|::|:     ....|:.||.....::||   :.:|
  Fly   220 IGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSI-----CSNSLEAFPFSVGMLKSLVTFKCES 279

  Fly   215 NELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAK 279
            |.|..|||:...:  .:||.|.:|.|||..||                                 
  Fly   280 NGLTELPDSISYL--EQLEELVLSHNKLIRLP--------------------------------- 309

  Fly   280 LRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQ-L 343
                    :.||:|.:        |..|....|.|:|||:|:.:..||.||...||.|...|| :
  Fly   310 --------STIGMLRS--------LRFLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALPQNI 358

  Fly   344 AKLAMLKVLDLSHNH--------LDRVNLLALVPSRN-------LKYLDLSGNLQL---QVDEQQ 390
            ..|:.:|||::.:|:        |:.|||.::..|.|       |:|||.|...||   .:.:..
  Fly   359 GNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSDNQSQPLVPLQYLDASTKTQLTCFMLPQVT 423

  Fly   391 FKV----CQSQSQRHWSLVDVSGNNRAALPTTKI---------RQVSAQRNQN------------ 430
            ||:    .|.|:|..:..|..:.....|.|:.:|         ....||...|            
  Fly   424 FKMNSIQAQQQAQEQYEFVYANQQQPHASPSRRICFAEEATILSNAKAQPAPNYPSFVAAPPTPT 488

  Fly   431 --KTSGPWTMGFAETPGSGDCRKLSVY--QLRAA------------------------NYGGSD- 466
              :.:|...:..:.||...:.|::|.|  |.:||                        |....| 
  Fly   489 PDQMAGSVRLMRSPTPYPKELRQMSKYVRQAQAATSSANASEVREARVVTNGQIHCDSNNANQDV 553

  Fly   467 ------EALYGMFEALEGRGRAAQEMSHLVPDLMKQEQMVKDSAVRDYMKFTLL---AAQQQCGS 522
                  .|:||:          |.|.:|:.....:.:||......::|....|:   |..||   
  Fly   554 VDQATTSAIYGI----------APETTHIYGVYQQPQQMAHPVPTQEYYGLPLVNYEAHYQQ--- 605

  Fly   523 VRSAALFHLTRTRAPS---------KVRPLKSKRYVLRMASTGGLD--------AYLIRRTSQLR 570
                 |:....|..|:         :::||:.:....:...|..|:        .|..:....|.
  Fly   606 -----LYVEANTPLPTTHLNGDQDYELQPLQQQPMQQQALPTPRLEPPPYHIARVYTKKTPEDLN 665

  Fly   571 LTKPDVIQKDQIHSMPDPHVLELILSNDDEY--LVVGNAQLWSVMDIDRAAREIRKEEN 627
            |.: .:.|:.|...:.:..:.:..|:::..:  ..:|      ..|::.:..::..:.|
  Fly   666 LYE-SMRQRKQQQQLQEQTIYQDALNSNSNFKTTAIG------AQDVEESVDQLDYQNN 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/18 (33%)
LRR_8 109..169 CDD:290566 24/93 (26%)
leucine-rich repeat 111..135 CDD:275380 7/34 (21%)
leucine-rich repeat 136..158 CDD:275380 12/21 (57%)
leucine-rich repeat 159..183 CDD:275380 7/46 (15%)
leucine-rich repeat 184..209 CDD:275380 4/24 (17%)
LRR_8 205..266 CDD:290566 17/63 (27%)
leucine-rich repeat 210..230 CDD:275380 7/22 (32%)
leucine-rich repeat 232..255 CDD:275380 9/22 (41%)
LRR_RI <256..410 CDD:238064 44/176 (25%)
leucine-rich repeat 256..276 CDD:275380 0/19 (0%)
LRR_8 279..359 CDD:290566 25/88 (28%)
leucine-rich repeat 280..303 CDD:275380 3/22 (14%)
leucine-rich repeat 304..348 CDD:275380 18/44 (41%)
leucine-rich repeat 349..372 CDD:275380 9/30 (30%)
PP2Cc 461..655 CDD:294085 31/196 (16%)
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 51/174 (29%)
leucine-rich repeat 21..41 CDD:275380
LRR_8 40..98 CDD:290566 17/68 (25%)
leucine-rich repeat 42..64 CDD:275380 7/16 (44%)
leucine-rich repeat 65..87 CDD:275380 8/39 (21%)
LRR_8 86..140 CDD:290566 15/57 (26%)
leucine-rich repeat 88..110 CDD:275380 4/24 (17%)
leucine-rich repeat 111..133 CDD:275380 8/21 (38%)
leucine-rich repeat 134..156 CDD:275380 9/21 (43%)
LRR_8 156..213 CDD:290566 17/56 (30%)
leucine-rich repeat 157..179 CDD:275380 2/21 (10%)
leucine-rich repeat 180..202 CDD:275380 12/21 (57%)
leucine-rich repeat 203..225 CDD:275380 1/21 (5%)
leucine-rich repeat 226..248 CDD:275380 5/21 (24%)
leucine-rich repeat 272..294 CDD:275380 7/23 (30%)
LRR_8 279..328 CDD:290566 21/99 (21%)
leucine-rich repeat 295..317 CDD:275380 12/62 (19%)
leucine-rich repeat 318..340 CDD:275380 8/21 (38%)
LRR_8 340..396 CDD:290566 19/55 (35%)
leucine-rich repeat 364..386 CDD:275380 5/21 (24%)
PDZ_signaling 770..846 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.