DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and conv

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001286416.1 Gene:conv / 36588 FlyBaseID:FBgn0261269 Length:1092 Species:Drosophila melanogaster


Alignment Length:696 Identity:163/696 - (23%)
Similarity:261/696 - (37%) Gaps:185/696 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EEEQAATFGQTSPQKLSLKG-----SQLGGSILIGNYNYLTQL-EVCENEMEVLDLSSLAQLETL 94
            :|...||:.|.|...|:...     :..|..:|..:||.:|:: :.|        ...|.:|.|:
  Fly   410 DETTFATYFQLSYNNLTNLAQIPIQNMTGLKVLNASYNSITEIPKNC--------FPKLYELHTI 466

  Fly    95 KCSRNKLMELIINGT-----NLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWV- 153
            ..|.|.:.. |.||.     :|:::...||.:..|.::....:|..|: :|:|||   ||.:.| 
  Fly   467 DVSHNNISS-IFNGVFQTLFSLRSIDLSHNSMREIKSSTFGTLPTLLE-MDLSHN---ELVSVVR 526

  Fly   154 GACASLTAINA-----------------------SHNRLNNV-----AVLLRNYRITELVSLDLA 190
            |:.|.||::..                       |||||.|:     .|:      ..|:.|||:
  Fly   527 GSLAKLTSLRQLYLNNNQLEKLFQLPISLNELYFSHNRLTNIPSGTWPVM------NSLIYLDLS 585

  Fly   191 YNDLKQL---DQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNN 252
            :|.|...   :.| .|...::.|:||:|.:...|.:..||. :.|:.|::..|.::||.|.....
  Fly   586 HNQLGDTLNGESF-TGLLVVQRLKLQNNGISQPPKDAVAVM-STLQYLHLENNNITTLERSAFGK 648

  Fly   253 HAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQL 317
            ...|..|:|.||.:.|..........:|..|:|:.|.|..|........|.|..|.||.|.|.:|
  Fly   649 LPVLFELNLYGNQVKDISKRAFEGLLQLLTLNLSSNGIQTLQNDIFVGLPSLRNLDLSFNSLTKL 713

  Fly   318 PEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSR-----NLKYLD 377
            ..:.            |.:      |..|..|:.||||||.:..|..... ||.     ||:.|:
  Fly   714 DNKT------------NGV------LDDLLSLETLDLSHNRISFVTKKTF-PSHQYIPYNLRNLN 759

  Fly   378 LSGNL----------------QLQVDEQQ-----------FKVCQS-----------QSQRH--- 401
            ||.||                :|.|...|           |...||           :|:.|   
  Fly   760 LSYNLMPILTYDITFGTKKLVRLDVSHNQINDLRRGVISNFTSLQSLDMSYNELSNLKSEEHIFD 824

  Fly   402 ----WSLVDVSGNNRAALPTTKIRQVSAQRNQNKTSGPWTMGFAETPGS--GDCRKLSVYQLRAA 460
                .|.:|:|.|....||...:.:|.:.:..:.|:.    ...:.|.|  |..|..| ..|.|.
  Fly   825 LPQNLSWLDLSHNKIYHLPFANLVKVKSLKYVDLTNN----SLEDVPASIVGSMRNGS-QVLLAG 884

  Fly   461 N---YGGSDEAL-YGMFEALEGRGRAAQEMSHL---VPDLMKQEQMVKDSAVRDYMKFTLLAAQQ 518
            |   .|.:...| |.|.:    :..|.:::..:   .|.|:|.:|::  |...:|    |..|:.
  Fly   885 NPLHCGCNARPLKYFMLQ----QTIAGEDLKSIYCGTPALIKDKQLI--SLDDEY----LHCAED 939

  Fly   519 QCGSVRSAALFHLTRTRAPSKVRPLKSKR--------YVLRMASTGGLDAYLIRRTSQLRLTKPD 575
            :....:......||..|    .|.:|:.:        ||...:.......| ||.:|...|.:.|
  Fly   940 EQEMYKGIDYEQLTDVR----FREVKTNKAGMLTLCWYVSGFSDVSDFHVY-IRSSSNDVLHQSD 999

  Fly   576 VIQKDQIHSMPDPHVLEL-----------ILSNDDEYLVVGNAQLW 610
            ....::...:|...:..|           |:|.|.:    ||.:.|
  Fly  1000 YAYNNRTAQIPVEELSTLGEEKLRGAEICIVSRDSD----GNTRKW 1041

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/23 (30%)
LRR_8 109..169 CDD:290566 20/88 (23%)
leucine-rich repeat 111..135 CDD:275380 5/23 (22%)
leucine-rich repeat 136..158 CDD:275380 9/22 (41%)
leucine-rich repeat 159..183 CDD:275380 9/51 (18%)
leucine-rich repeat 184..209 CDD:275380 8/27 (30%)
LRR_8 205..266 CDD:290566 18/60 (30%)
leucine-rich repeat 210..230 CDD:275380 7/19 (37%)
leucine-rich repeat 232..255 CDD:275380 6/22 (27%)
LRR_RI <256..410 CDD:238064 51/203 (25%)
leucine-rich repeat 256..276 CDD:275380 6/19 (32%)
LRR_8 279..359 CDD:290566 24/79 (30%)
leucine-rich repeat 280..303 CDD:275380 6/22 (27%)
leucine-rich repeat 304..348 CDD:275380 10/43 (23%)
leucine-rich repeat 349..372 CDD:275380 10/27 (37%)
PP2Cc 461..655 CDD:294085 35/176 (20%)
convNP_001286416.1 leucine-rich repeat 125..148 CDD:275380
leucine-rich repeat 150..175 CDD:275380
leucine-rich repeat 176..199 CDD:275380
LRR_8 198..258 CDD:290566
leucine-rich repeat 200..223 CDD:275380
LRR_RI 201..545 CDD:238064 37/147 (25%)
leucine-rich repeat 224..271 CDD:275380
LRR_8 245..306 CDD:290566
leucine-rich repeat 272..295 CDD:275380
LRR_8 296..354 CDD:290566
leucine-rich repeat 296..319 CDD:275380
LRR_8 322..401 CDD:290566
leucine-rich repeat 322..343 CDD:275380
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 371..390 CDD:275380
leucine-rich repeat 391..414 CDD:275380 1/3 (33%)
leucine-rich repeat 416..438 CDD:275380 4/21 (19%)
LRR_8 437..495 CDD:290566 15/66 (23%)
leucine-rich repeat 439..462 CDD:275380 6/30 (20%)
leucine-rich repeat 463..486 CDD:275380 7/23 (30%)
LRR_RI 486..738 CDD:238064 75/281 (27%)
LRR_8 486..545 CDD:290566 17/62 (27%)
leucine-rich repeat 487..510 CDD:275380 4/22 (18%)
leucine-rich repeat 511..534 CDD:275380 11/26 (42%)
leucine-rich repeat 535..554 CDD:275380 0/18 (0%)
LRR_8 554..614 CDD:290566 19/66 (29%)
leucine-rich repeat 555..578 CDD:275380 7/28 (25%)
leucine-rich repeat 579..603 CDD:275380 8/24 (33%)
leucine-rich repeat 604..627 CDD:275380 7/23 (30%)
LRR_8 626..710 CDD:290566 24/83 (29%)
leucine-rich repeat 628..649 CDD:275380 6/20 (30%)
leucine-rich repeat 652..672 CDD:275380 6/19 (32%)
LRR_8 698..765 CDD:290566 27/85 (32%)
leucine-rich repeat 700..726 CDD:275380 10/43 (23%)
leucine-rich repeat 727..745 CDD:275380 8/17 (47%)
LRR_8 777..839 CDD:290566 12/61 (20%)
leucine-rich repeat 779..802 CDD:275380 4/22 (18%)
leucine-rich repeat 829..852 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.