DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Ac3

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_610116.2 Gene:Ac3 / 35419 FlyBaseID:FBgn0023416 Length:1167 Species:Drosophila melanogaster


Alignment Length:457 Identity:84/457 - (18%)
Similarity:157/457 - (34%) Gaps:119/457 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KATRKQADPYKSKL---KVSASHSGPHPLPVEVTAAEEEQAATFG--QTSPQKLSLKGSQLGGSI 62
            |..:..|.|...|:   :...:|..|:....::.:.|::..||..  :...|.....|.|:|   
  Fly   478 KVVKAFASPCAKKINETQAEIAHPNPNGSTTDIVSDEDDNDATLDDEELLAQNSVSNGHQIG--- 539

  Fly    63 LIGNYNYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTT 127
                      :.|..:|.|.:.|.:..|         :|.:.::.....:.|..|.|....... 
  Fly   540 ----------IAVTADEEEQVKLENFKQ---------RLKDELVTRDGHENLTKDTNIFLRFKN- 584

  Fly   128 NTHPVPLKLQRIDISHNNFSELP-------NWVGACASLTAINASHNRLNNVAVLLRNYRITELV 185
                 |...|...:....:|.||       ..:....|...:..|.....|:|..|  ..|..||
  Fly   585 -----PQLEQLYAVYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPL--VPIAMLV 642

  Fly   186 SLDLA-----------------YNDLKQLDQFPE-------GFSSIRSLQLQSNELPSLPDNFFA 226
            .:.||                 :||:..:.:...       |||::             .|.||.
  Fly   643 VISLAESFSGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGFSNV-------------IDMFFF 694

  Fly   227 VTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKL-RVLHLAY-NR 289
            ||..|.|.: ||.::.:.....|.:.:..:..:..|.:.|..|..|.:.:|... |||:.:| :.
  Fly   695 VTFVRTEHI-VSESEFNVTASLESDINLVVEGMVTAEHLLPASFVEQMRDAVPTERVLYPSYLSN 758

  Fly   290 IGVLPAACVRNWPELEILVLSGNMLQQLPE--EVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVL 352
            .|||             ::::..::.||..  ::..|..:..|.|..|:.:       :..|..|
  Fly   759 FGVL-------------ILIAIAVIAQLTHLTKILLLLSIAALHCYFNIFI-------MQDLYAL 803

  Fly   353 DLSHNHLDRVN----------LLALVPSRNLKYLDLSGNL----QLQVDEQQFKVCQSQSQRHWS 403
            :....|...::          :.||..|...:::|....:    :.:|.||: :......||:.:
  Fly   804 EDDFEHQPIISTRYAASGLLLVAALALSTLARHMDHEDRVIFKWKTEVAEQK-ETANDMRQRNEA 867

  Fly   404 LV 405
            ||
  Fly   868 LV 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 1/18 (6%)
LRR_8 109..169 CDD:290566 10/66 (15%)
leucine-rich repeat 111..135 CDD:275380 4/23 (17%)
leucine-rich repeat 136..158 CDD:275380 4/28 (14%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 9/48 (19%)
LRR_8 205..266 CDD:290566 12/60 (20%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 4/22 (18%)
LRR_RI <256..410 CDD:238064 32/168 (19%)
leucine-rich repeat 256..276 CDD:275380 4/19 (21%)
LRR_8 279..359 CDD:290566 15/83 (18%)
leucine-rich repeat 280..303 CDD:275380 7/24 (29%)
leucine-rich repeat 304..348 CDD:275380 6/45 (13%)
leucine-rich repeat 349..372 CDD:275380 6/32 (19%)
PP2Cc 461..655 CDD:294085
Ac3NP_610116.2 AC_N <127..285 CDD:292831
CYCc 256..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
CYCc 860..1071 CDD:214485 4/10 (40%)
Guanylate_cyc 892..1092 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.