| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001073929.1 | Gene: | LRRIQ4 / 344657 | HGNCID: | 34298 | Length: | 560 | Species: | Homo sapiens |
| Alignment Length: | 360 | Identity: | 105/360 - (29%) |
|---|---|---|---|
| Similarity: | 160/360 - (44%) | Gaps: | 54/360 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 69 YLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMEL---IINGTNLQTLVADHNYLHNISTTNTH 130
Fly 131 PVPL----KLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNY-RITELVSLDLA 190
Fly 191 YNDLKQLDQFPEGFSSIRSLQ---LQSNELPSLPDNFFAVTHARLETL-NVSCNKLSTLPRYEQN 251
Fly 252 NHAALVN---LSLAGNHLNDSIFEPLHNAA--KLRVLHLAYNRIGVLPAACVRNWPELEILVLSG 311
Fly 312 NMLQQLPEEVATLGQLRVLRCCNN----LLLCTPQLAKLAMLKVLDLSHNHLDRVNL-LALVPSR 371
Fly 372 NLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVD 406 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 8/21 (38%) |
| LRR_8 | 109..169 | CDD:290566 | 13/63 (21%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | 4/27 (15%) | ||
| leucine-rich repeat | 136..158 | CDD:275380 | 6/21 (29%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 6/24 (25%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 8/24 (33%) | ||
| LRR_8 | 205..266 | CDD:290566 | 16/67 (24%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 4/23 (17%) | ||
| LRR_RI | <256..410 | CDD:238064 | 56/161 (35%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 279..359 | CDD:290566 | 29/83 (35%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | 16/47 (34%) | ||
| leucine-rich repeat | 349..372 | CDD:275380 | 8/23 (35%) | ||
| PP2Cc | 461..655 | CDD:294085 | |||
| LRRIQ4 | NP_001073929.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | ||
| LRR 1 | 23..47 | ||||
| LRR 2 | 48..70 | ||||
| leucine-rich repeat | 50..72 | CDD:275380 | |||
| LRR 3 | 72..95 | ||||
| leucine-rich repeat | 73..119 | CDD:275380 | |||
| LRR 4 | 97..116 | ||||
| LRR_RI | 117..360 | CDD:238064 | 74/260 (28%) | ||
| LRR 5 | 117..140 | 5/17 (29%) | |||
| LRR_8 | 120..177 | CDD:290566 | 17/54 (31%) | ||
| leucine-rich repeat | 120..143 | CDD:275380 | 6/20 (30%) | ||
| LRR 6 | 141..164 | 8/22 (36%) | |||
| leucine-rich repeat | 144..166 | CDD:275380 | 8/21 (38%) | ||
| LRR 7 | 166..187 | 4/26 (15%) | |||
| leucine-rich repeat | 167..189 | CDD:275380 | 4/27 (15%) | ||
| LRR 8 | 188..210 | 6/24 (25%) | |||
| LRR_8 | 189..246 | CDD:290566 | 17/62 (27%) | ||
| leucine-rich repeat | 190..212 | CDD:275380 | 7/24 (29%) | ||
| LRR 9 | 212..233 | 4/20 (20%) | |||
| leucine-rich repeat | 213..235 | CDD:275380 | 4/21 (19%) | ||
| LRR_8 | 234..315 | CDD:290566 | 24/90 (27%) | ||
| LRR 10 | 234..256 | 8/24 (33%) | |||
| leucine-rich repeat | 236..258 | CDD:275380 | 8/24 (33%) | ||
| LRR_RI | 253..501 | CDD:238064 | 67/217 (31%) | ||
| LRR 11 | 258..281 | 4/22 (18%) | |||
| leucine-rich repeat | 259..304 | CDD:275380 | 10/51 (20%) | ||
| LRR 12 | 283..301 | 4/24 (17%) | |||
| LRR 13 | 302..325 | 10/25 (40%) | |||
| leucine-rich repeat | 305..327 | CDD:275380 | 8/24 (33%) | ||
| LRR 14 | 326..348 | 9/22 (41%) | |||
| leucine-rich repeat | 328..350 | CDD:275380 | 9/22 (41%) | ||
| LRR 15 | 350..371 | 10/20 (50%) | |||
| leucine-rich repeat | 351..370 | CDD:275380 | 10/18 (56%) | ||
| leucine-rich repeat | 374..399 | CDD:275380 | 5/24 (21%) | ||
| LRR 16 | 374..397 | 3/22 (14%) | |||
| LRR 17 | 398..422 | 8/25 (32%) | |||
| LRR_8 | 399..456 | CDD:290566 | 20/60 (33%) | ||
| leucine-rich repeat | 400..422 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 423..445 | CDD:275380 | 8/24 (33%) | ||
| LRR 18 | 424..443 | 6/21 (29%) | |||
| LRR 19 | 444..466 | 3/10 (30%) | |||
| leucine-rich repeat | 446..468 | CDD:275380 | 2/8 (25%) | ||
| LRR 20 | 468..489 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 529..560 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||