DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and CG32305

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster


Alignment Length:534 Identity:101/534 - (18%)
Similarity:172/534 - (32%) Gaps:203/534 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LPVEVTAAEEEQAATFGQTSPQKLSLKGSQL----GGSILIG---NYNYLTQLEVCENEMEVL-- 83
            |..|:.:..|:|...|   :|.|..|:...|    ..|||:.   ||.:||........:|:|  
  Fly   264 LQEEICSRIEDQDKNF---TPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHD 325

  Fly    84 -----DLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNY---------------LH---NIS 125
                 ||::         :||:.|.:...|.:...:....||               :|   .:|
  Fly   326 LFVNFDLAA---------NRNRAMRIKFLGDSYNCVAGIPNYFPAHASCCVDQALEMIHITQGVS 381

  Fly   126 TTNTHPVPLKL-----------------------QRIDISHN-NFSELPNWVGACASLTAINASH 166
            :.....:.|::                       :.:||::. ..|.||..|            |
  Fly   382 SRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLV------------H 434

  Fly   167 NRLNNVAVLLRNYRITELVSLDLAYND--LKQLDQFPEGFSSIRSLQLQSNELP------SLPDN 223
            .....:::|..:|...|  ..:.|.||  |:|        :.||:. |.||.||      .|.|.
  Fly   435 VSQRTLSMLDEHYIFRE--GTEAAKNDPILQQ--------AGIRTF-LVSNRLPDAVEPGELDDE 488

  Fly   224 F---------------------------------FAVTHARLETLNVSCNKLSTLPRYEQNNHAA 255
            .                                 .||.|..:|     ..:.|::.:.:.|....
  Fly   489 LSSASINSCRLSYGGYYEEIQIKAQREIMKEVDQMAVGHCFIE-----WRRSSSMKKQDFNEEYL 548

  Fly   256 LVNLSLAGNHLNDSIFE------PLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNML 314
            ..|..    ||...:|.      ..||   |..|.:.|..:.||.|.         :.::|.|::
  Fly   549 FSNQI----HLVLGVFRSWKREWEFHN---LPDLMIKYTMLLVLCAG---------LAIMSINLI 597

  Fly   315 QQ--LPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLD 377
            ::  .|:.:..||.|.:|     |:||.     ||..|.|.|....|..::..:...||.|  |.
  Fly   598 EEATYPDILVLLGILLIL-----LILCI-----LAGYKKLRLQWKKLTPMSQPSCFLSRWL--LR 650

  Fly   378 LSGNLQ----------------LQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQ 426
            :|..::                |.|...|.......::...|:::....|              :
  Fly   651 ISERIEDSLFVRIPLTMVVLLLLYVMSSQAVFSCDVAKLELSIIEAHLYN--------------E 701

  Fly   427 RNQNKTSGPWTMGF 440
            ::..:..||||:.:
  Fly   702 KSYAECFGPWTVTY 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 4/18 (22%)
LRR_8 109..169 CDD:290566 12/101 (12%)
leucine-rich repeat 111..135 CDD:275380 4/41 (10%)
leucine-rich repeat 136..158 CDD:275380 6/45 (13%)
leucine-rich repeat 159..183 CDD:275380 3/23 (13%)
leucine-rich repeat 184..209 CDD:275380 6/26 (23%)
LRR_8 205..266 CDD:290566 16/99 (16%)
leucine-rich repeat 210..230 CDD:275380 9/58 (16%)
leucine-rich repeat 232..255 CDD:275380 3/22 (14%)
LRR_RI <256..410 CDD:238064 37/177 (21%)
leucine-rich repeat 256..276 CDD:275380 4/25 (16%)
LRR_8 279..359 CDD:290566 21/81 (26%)
leucine-rich repeat 280..303 CDD:275380 6/22 (27%)
leucine-rich repeat 304..348 CDD:275380 11/45 (24%)
leucine-rich repeat 349..372 CDD:275380 5/22 (23%)
PP2Cc 461..655 CDD:294085
CG32305NP_728725.2 CYCc 251..449 CDD:214485 38/208 (18%)
Nucleotidyl_cyc_III 292..445 CDD:299850 28/173 (16%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.