DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Lrrc40

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_006233600.1 Gene:Lrrc40 / 310946 RGDID:1562017 Length:602 Species:Rattus norvegicus


Alignment Length:353 Identity:100/353 - (28%)
Similarity:170/353 - (48%) Gaps:47/353 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GQTSPQKLSLKGSQLGGSILIGNYN--------YLTQLEVCENEMEVLDLSSLAQLETLKCSRNK 100
            |.|.||.| ||.::..|.:.:...|        :...:::.|...:.|..||..:.    ..:..
  Rat    24 GPTVPQGL-LKAARSSGQLNLAGRNLGEVPQCVWRINVDIPEEANQNLSFSSTERW----WEQTD 83

  Fly   101 LMELIINGTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINAS 165
            |.:|||:...||:|..|...|..::.            :||..|..:.||:.:....:|..:|.|
  Rat    84 LTKLIISSNKLQSLSDDLRLLPALTV------------LDIHDNQLTSLPSAIRELDNLQKLNVS 136

  Fly   166 HNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGF---SSIRSLQLQSNELPSLPDNFFAV 227
            ||:|..:...:.:  :..|.:|.|.:|:|..:   ||||   ||:..|.|.||.|.::|.:|..:
  Rat   137 HNKLKMLPEEITS--LKNLKALHLQHNELTCI---PEGFEHLSSLEDLDLSSNRLATVPADFALL 196

  Fly   228 THARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGV 292
            ::  |..||:|.|:|..||. |.:....|.:|....| |.:::...:.:...|.:|:|..|::.|
  Rat   197 SN--LLRLNLSSNQLKNLPA-EISRMKRLKHLDCDAN-LLETVPPDVGSMESLELLYLRRNKLRV 257

  Fly   293 LP--AACVRNWPELEILVLSGNMLQQL-PEEVATLGQLRVLRCCNNLLLCTP-QLAKLAMLKVLD 353
            ||  .:|    .:|:.|.|:.|.:::| .|.:..|..:.||...:|.|...| ::|.|..|:.||
  Rat   258 LPEFPSC----RQLKELYLAENQIEKLGAEHLQHLQAILVLDLRSNKLRSVPEEMALLQSLERLD 318

  Fly   354 LSHNHLDRVNLLALVPSRNLKYLDLSGN 381
            ||:|  |..:|...:.:.:||:|.|.||
  Rat   319 LSNN--DISSLPCSLGNLHLKFLALEGN 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 4/18 (22%)
LRR_8 109..169 CDD:290566 15/59 (25%)
leucine-rich repeat 111..135 CDD:275380 5/23 (22%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 6/23 (26%)
leucine-rich repeat 184..209 CDD:275380 11/27 (41%)
LRR_8 205..266 CDD:290566 21/60 (35%)
leucine-rich repeat 210..230 CDD:275380 7/19 (37%)
leucine-rich repeat 232..255 CDD:275380 9/22 (41%)
LRR_RI <256..410 CDD:238064 40/130 (31%)
leucine-rich repeat 256..276 CDD:275380 4/19 (21%)
LRR_8 279..359 CDD:290566 28/83 (34%)
leucine-rich repeat 280..303 CDD:275380 8/24 (33%)
leucine-rich repeat 304..348 CDD:275380 14/45 (31%)
leucine-rich repeat 349..372 CDD:275380 8/22 (36%)
PP2Cc 461..655 CDD:294085
Lrrc40XP_006233600.1 leucine-rich repeat 84..106 CDD:275380 9/21 (43%)
PLN00113 89..>577 CDD:215061 84/283 (30%)
leucine-rich repeat 107..129 CDD:275380 5/33 (15%)
leucine-rich repeat 130..152 CDD:275380 6/23 (26%)
leucine-rich repeat 153..175 CDD:275380 9/24 (38%)
leucine-rich repeat 176..221 CDD:275380 16/47 (34%)
leucine-rich repeat 222..244 CDD:275380 4/22 (18%)
leucine-rich repeat 245..266 CDD:275380 8/24 (33%)
leucine-rich repeat 267..290 CDD:275380 7/22 (32%)
leucine-rich repeat 291..313 CDD:275380 7/21 (33%)
leucine-rich repeat 427..473 CDD:275380
leucine-rich repeat 474..496 CDD:275380
leucine-rich repeat 497..519 CDD:275380
leucine-rich repeat 520..543 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45752
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.