Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011530203.1 | Gene: | GUCY1B1 / 2983 | HGNCID: | 4687 | Length: | 662 | Species: | Homo sapiens |
Alignment Length: | 321 | Identity: | 67/321 - (20%) |
---|---|---|---|
Similarity: | 103/321 - (32%) | Gaps: | 116/321 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 245 LPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAAC--VRNWPELEIL 307
Fly 308 VLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVP--- 369
Fly 370 -SRNLKYLD---------------LSGNLQLQV----DE------------QQFKV------CQS 396
Fly 397 QSQRHWSLVDVSGNNRAALPTTKI----------------RQVSAQRNQNKT---SGPWTMGFAE 442
Fly 443 TPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALEGRGRAAQEMSHLVPDLMKQEQMVKDS 503 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
LRR_8 | 109..169 | CDD:290566 | |||
leucine-rich repeat | 111..135 | CDD:275380 | |||
leucine-rich repeat | 136..158 | CDD:275380 | |||
leucine-rich repeat | 159..183 | CDD:275380 | |||
leucine-rich repeat | 184..209 | CDD:275380 | |||
LRR_8 | 205..266 | CDD:290566 | 6/20 (30%) | ||
leucine-rich repeat | 210..230 | CDD:275380 | |||
leucine-rich repeat | 232..255 | CDD:275380 | 3/9 (33%) | ||
LRR_RI | <256..410 | CDD:238064 | 44/196 (22%) | ||
leucine-rich repeat | 256..276 | CDD:275380 | 6/19 (32%) | ||
LRR_8 | 279..359 | CDD:290566 | 19/81 (23%) | ||
leucine-rich repeat | 280..303 | CDD:275380 | 4/24 (17%) | ||
leucine-rich repeat | 304..348 | CDD:275380 | 12/43 (28%) | ||
leucine-rich repeat | 349..372 | CDD:275380 | 5/26 (19%) | ||
PP2Cc | 461..655 | CDD:294085 | 7/43 (16%) | ||
GUCY1B1 | XP_011530203.1 | HNOB | 2..166 | CDD:311572 | |
HNOBA | 207..449 | CDD:311573 | 48/230 (21%) | ||
Guanylate_cyc | 455..648 | CDD:306677 | 18/84 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |