DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Lrrd1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_216085.3 Gene:Lrrd1 / 296836 RGDID:1562785 Length:855 Species:Rattus norvegicus


Alignment Length:729 Identity:156/729 - (21%)
Similarity:293/729 - (40%) Gaps:174/729 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KQADPYKSKLKVSASHSGPHPLPVEVTAA--------EEEQAATFGQTSP------QKLSLKGSQ 57
            |..|.......|.....|....||::...        ::.|..||....|      :.|||:.:.
  Rat   131 KGFDMESDTFTVHLDAKGLQEFPVDIVKVKYVKYLYLDKNQIKTFQGADPGDLLGLETLSLQENG 195

  Fly    58 LGG-----------SILIGNYNYLT-------------QLEVCENEMEVL--DLSSLAQLETLKC 96
            |..           .:|..:||.::             ||.:..|.:|.|  .|.:|..||||..
  Rat   196 LSSIPQEIQLFHNLKVLNASYNEISHIPKELLQLGNMRQLFLNSNHIESLPSGLENLRYLETLSL 260

  Fly    97 SRNKLMEL---IINGTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACAS 158
            .:|:|..:   :....||:||..::|.| .|.:.:...:| ||..::::.|....||..|....:
  Rat   261 GKNRLTHIPDSLCGLKNLKTLNLEYNQL-TIFSKSLCFLP-KLVSLNLTGNMIGSLPKEVRELKN 323

  Fly   159 LTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDN 223
            |..:..:||:|..:||.:  :::.::..|.||.|.|:.:....|.|..:|.|.|.:|.|.|||..
  Rat   324 LENLLMNHNKLTFLAVEI--FQLLKIKELHLADNKLEAISPKIENFKELRLLNLDNNLLQSLPKK 386

  Fly   224 FFAVTH-ARLETLNVSCNKLSTLPR---------------------YEQNNHAALV-NLSLAGNH 265
               ::| ..||:|.:|.|.|..||:                     .|:.:|.:.: :|..:||.
  Rat   387 ---ISHCVNLESLTLSDNNLEELPKKIRKLKNLRQLHANRNKMIKMAEEISHLSKIHSLEFSGNQ 448

  Fly   266 LNDSIFEPLHNAAKLRVLHLAYNRIGVLPAA-CVRNWPELEILVLSGNMLQQLPEEVATLGQLRV 329
            :.....| :.|..::..:.|.||.|...|.. |...  .|:.|..:||.:.::|.:::...||..
  Rat   449 ITHVPIE-IKNCKEITRVELNYNNIMYFPVGLCALQ--SLDYLSFNGNYISEIPVDLSFSKQLLH 510

  Fly   330 LRC-CNNLLLCTPQLAKLAMLKVLDLSHNHLDRVN--LLALVPSRNLKYLDLSGNLQLQVDEQQF 391
            |.. .|.:.:.:..|..|..|:.|||:.|.:.::.  :.|::   :|..|.||.|        :|
  Rat   511 LELNKNKITIFSEHLCSLTNLEYLDLAKNQIRKIPHCISAML---SLHVLILSDN--------KF 564

  Fly   392 KVCQSQ--SQRHWSLVDVSGNNRAALPT--TKIRQVSAQR--NQNKTSGPWTMGFAETPGSGDCR 450
            ::...:  |.::..|:|:|.|....:|:  :|::::....  |.|.|..|     ||.     |:
  Rat   565 EIFPKELCSLKNLQLLDISENQLHKIPSEISKLKKIQKLNLSNNNFTHFP-----AEL-----CQ 619

  Fly   451 KLSVYQLRAANYGGSDEALYGMFEALEGRGRAAQEMSHLVPDLMKQEQM----VKDSAVRDYMKF 511
            ..::..|..:...|                   ::::.|..::.:..|:    :.::|:::    
  Rat   620 LQTLEDLNISQISG-------------------KKLTRLPEEVSRMTQLKALNISNNAIKE---- 661

  Fly   512 TLLAAQQQCGSVRSAALFHLTRTR---APSKVRPLKSKRYVLRMASTGGLD----AYLIRRTSQL 569
                ..:..|.:|:...||.:..:   .||....|.    ||:....||.:    ...|.:.|.|
  Rat   662 ----IPRNIGELRNLITFHASNNQINSLPSSFLSLN----VLQSLDLGGNNLTDLPSAIYKLSSL 718

  Fly   570 R--------LTKP--DVIQKDQIHSMP---------DPHVLELILSNDDEYLVVGNAQLWSVMDI 615
            :        |.:|  ::.:..|:|::.         |..:||.|      :.:|.|....:..:.
  Rat   719 KEINFDDNPLLRPPMEICKGKQMHTITCYLQRADDRDEKILEKI------FHIVANNITETKFEF 777

  Fly   616 DRAAREIRKEENSL 629
            .:....:.:.|||:
  Rat   778 LQQKLHMARSENSV 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/21 (29%)
LRR_8 109..169 CDD:290566 17/59 (29%)
leucine-rich repeat 111..135 CDD:275380 7/23 (30%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 6/23 (26%)
leucine-rich repeat 184..209 CDD:275380 7/24 (29%)
LRR_8 205..266 CDD:290566 22/83 (27%)
leucine-rich repeat 210..230 CDD:275380 8/20 (40%)
leucine-rich repeat 232..255 CDD:275380 10/43 (23%)
LRR_RI <256..410 CDD:238064 38/160 (24%)
leucine-rich repeat 256..276 CDD:275380 4/20 (20%)
LRR_8 279..359 CDD:290566 22/81 (27%)
leucine-rich repeat 280..303 CDD:275380 6/23 (26%)
leucine-rich repeat 304..348 CDD:275380 11/44 (25%)
leucine-rich repeat 349..372 CDD:275380 6/24 (25%)
PP2Cc 461..655 CDD:294085 31/199 (16%)
Lrrd1XP_216085.3 leucine-rich repeat 162..185 CDD:275380 4/22 (18%)
LRR_8 185..242 CDD:290566 10/56 (18%)
leucine-rich repeat 186..208 CDD:275380 4/21 (19%)
leucine-rich repeat 209..231 CDD:275380 3/21 (14%)
leucine-rich repeat 232..254 CDD:275380 7/21 (33%)
LRR_RI 253..564 CDD:238064 85/331 (26%)
LRR_8 253..311 CDD:290566 17/59 (29%)
leucine-rich repeat 255..277 CDD:275380 6/21 (29%)
leucine-rich repeat 278..300 CDD:275380 7/23 (30%)
LRR_8 299..357 CDD:290566 17/60 (28%)
leucine-rich repeat 301..323 CDD:275380 5/21 (24%)
leucine-rich repeat 324..346 CDD:275380 6/23 (26%)
leucine-rich repeat 347..392 CDD:275380 16/47 (34%)
leucine-rich repeat 439..461 CDD:275380 5/22 (23%)
leucine-rich repeat 463..484 CDD:275380 6/22 (27%)
leucine-rich repeat 487..507 CDD:275380 4/19 (21%)
leucine-rich repeat 508..530 CDD:275380 5/21 (24%)
leucine-rich repeat 531..553 CDD:275380 6/24 (25%)
LRR_RI 537..>728 CDD:238064 41/242 (17%)
LRR_8 553..610 CDD:290566 14/64 (22%)
leucine-rich repeat 554..576 CDD:275380 7/29 (24%)
leucine-rich repeat 577..599 CDD:275380 6/21 (29%)
leucine-rich repeat 600..648 CDD:275380 10/76 (13%)
leucine-rich repeat 649..671 CDD:275380 2/29 (7%)
LRR_8 670..728 CDD:290566 13/61 (21%)
leucine-rich repeat 672..694 CDD:275380 5/25 (20%)
leucine-rich repeat 695..717 CDD:275380 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.