DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AT3G25505

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001327784.1 Gene:AT3G25505 / 28719319 AraportID:AT3G25505 Length:562 Species:Arabidopsis thaliana


Alignment Length:481 Identity:87/481 - (18%)
Similarity:157/481 - (32%) Gaps:187/481 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KVSASHSGPHPLPVEVTAAEEE----QAATFGQTSP----QKLSLKGSQLGGSILIGNYNYLTQL 73
            |:..:|...|...|:..:..|.    ..:..|:..|    |:|:|:.:.|.|::.:|       |
plant   151 KLLKAHGINHIYKVDYPSTHEACQIFCMSAVGKKFPKDEFQELALEVTNLLGNLPLG-------L 208

  Fly    74 EVCENEMEVLD----LSSLAQLET---------LK------CSRNKLMELIINGTNLQTLVADHN 119
            .|..:....:.    :::|.:|.|         ||      |..:|.:.|.|..|      .::.
plant   209 RVMGSHFRGMSKQEWINALPRLRTHLDSNIQSILKFSYDALCREDKDLFLHIACT------FNNK 267

  Fly   120 YLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLL-------- 176
            .:.|:....||......||..:.            |..||.:|.....:::|:..||        
plant   268 RIENVEAHLTHKFLDTKQRFHVL------------AEKSLISIEEGWIKMHNLLELLGREIVCHE 320

  Fly   177 ---------RNY-----RITELVSLD--------LAYNDLKQLDQFP------EGFSSIRSLQLQ 213
                     |.:     .|.|:::.|        :.:|..:.|.:..      ||.|:::.|:::
plant   321 HESIREPGKRQFLVDARDICEVLTDDTGSKSVVGIYFNSAELLGELNISERAFEGMSNLKFLRIK 385

  Fly   214 SNE--------------------------LPSLPDNF-------FAVTHARLETL---NVSCNKL 242
            .:.                          |..||.||       ..:.|::|..|   |:|...|
plant   386 CDRSDKMYLPRGLKYISRKLRLLEWDRFPLTCLPSNFCTEYLVELNMRHSKLVKLWEGNLSLGNL 450

  Fly   243 STLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEIL 307
            ..:..:...|...|.:.|.|.|                                       |:.|
plant   451 KWMNLFHSKNLKELPDFSTATN---------------------------------------LQTL 476

  Fly   308 VLSG-NMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNL-----LA 366
            :|.| :.|.:||..:.:...|:.|..|.    ||..:...|.:..|    :.|..|.|     |.
plant   477 ILCGCSSLVELPYSIGSANNLQKLHLCR----CTSLVELPASIGNL----HKLQNVTLKGCSKLE 533

  Fly   367 LVPSRNLKYLDLSGNLQLQVDEQQFK 392
            :||:          |:.|.:|.:::|
plant   534 VVPT----------NINLILDVKKYK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 8/33 (24%)
LRR_8 109..169 CDD:290566 10/59 (17%)
leucine-rich repeat 111..135 CDD:275380 3/23 (13%)
leucine-rich repeat 136..158 CDD:275380 3/21 (14%)
leucine-rich repeat 159..183 CDD:275380 7/45 (16%)
leucine-rich repeat 184..209 CDD:275380 6/38 (16%)
LRR_8 205..266 CDD:290566 18/96 (19%)
leucine-rich repeat 210..230 CDD:275380 6/52 (12%)
leucine-rich repeat 232..255 CDD:275380 6/25 (24%)
LRR_RI <256..410 CDD:238064 28/143 (20%)
leucine-rich repeat 256..276 CDD:275380 4/19 (21%)
LRR_8 279..359 CDD:290566 14/80 (18%)
leucine-rich repeat 280..303 CDD:275380 0/22 (0%)
leucine-rich repeat 304..348 CDD:275380 12/44 (27%)
leucine-rich repeat 349..372 CDD:275380 7/27 (26%)
PP2Cc 461..655 CDD:294085
AT3G25505NP_001327784.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.