| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_937893.1 | Gene: | Lrrc4b / 272381 | MGIID: | 3027390 | Length: | 709 | Species: | Mus musculus |
| Alignment Length: | 271 | Identity: | 72/271 - (26%) |
|---|---|---|---|
| Similarity: | 122/271 - (45%) | Gaps: | 55/271 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 138 RIDISHNNFSELPNWVGACASLTAINASHNRL--NNVAVL----LRNYRITELVSLDLAYNDLKQ 196
Fly 197 LD--QFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNL 259
Fly 260 SLAG----NHLNDSIFEPLHNAAKLRVLHLAYNRIGVLP--AACVRNWPELEILVLSGNMLQQLP 318
Fly 319 EEVATLGQLRVLRCCNNLLLCTPQLA--------KLAMLKVLDLSHNHLDRVNLLAL-----VPS 370
Fly 371 RNLKYLDLSGN 381 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
| LRR_8 | 109..169 | CDD:290566 | 6/30 (20%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | |||
| leucine-rich repeat | 136..158 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 5/29 (17%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 6/26 (23%) | ||
| LRR_8 | 205..266 | CDD:290566 | 16/64 (25%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 6/19 (32%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 6/22 (27%) | ||
| LRR_RI | <256..410 | CDD:238064 | 43/145 (30%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 6/23 (26%) | ||
| LRR_8 | 279..359 | CDD:290566 | 29/89 (33%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | 15/51 (29%) | ||
| leucine-rich repeat | 349..372 | CDD:275380 | 10/27 (37%) | ||
| PP2Cc | 461..655 | CDD:294085 | |||
| Lrrc4b | NP_937893.1 | LRRNT | 59..92 | CDD:214470 | 6/27 (22%) |
| LRR | <89..299 | CDD:227223 | 63/230 (27%) | ||
| LRR 1 | 89..110 | 4/20 (20%) | |||
| leucine-rich repeat | 90..113 | CDD:275380 | 3/22 (14%) | ||
| LRR 2 | 113..134 | 5/23 (22%) | |||
| leucine-rich repeat | 114..137 | CDD:275380 | 6/25 (24%) | ||
| LRR 3 | 137..158 | 7/20 (35%) | |||
| leucine-rich repeat | 138..161 | CDD:275380 | 6/23 (26%) | ||
| LRR 4 | 161..182 | 5/20 (25%) | |||
| leucine-rich repeat | 162..185 | CDD:275380 | 6/22 (27%) | ||
| LRR 5 | 185..207 | 4/21 (19%) | |||
| leucine-rich repeat | 186..210 | CDD:275380 | 6/23 (26%) | ||
| LRR 6 | 210..231 | 7/23 (30%) | |||
| leucine-rich repeat | 211..232 | CDD:275380 | 6/20 (30%) | ||
| LRR 7 | 232..253 | 10/29 (34%) | |||
| leucine-rich repeat | 233..256 | CDD:275380 | 10/27 (37%) | ||
| LRR 8 | 256..277 | 4/20 (20%) | |||
| leucine-rich repeat | 257..280 | CDD:275380 | 5/22 (23%) | ||
| LRR 9 | 280..301 | 9/25 (36%) | |||
| leucine-rich repeat | 281..302 | CDD:275380 | 9/25 (36%) | ||
| LRRCT | 313..363 | CDD:214507 | 1/1 (100%) | ||
| I-set | 366..455 | CDD:400151 | |||
| Ig strand A | 366..369 | CDD:409353 | |||
| Ig strand A' | 373..376 | CDD:409353 | |||
| Ig strand B | 382..389 | CDD:409353 | |||
| Ig strand C | 395..400 | CDD:409353 | |||
| Ig strand C' | 403..405 | CDD:409353 | |||
| Ig strand D | 414..418 | CDD:409353 | |||
| Ig strand E | 421..425 | CDD:409353 | |||
| Ig strand F | 435..442 | CDD:409353 | |||
| Ig strand G | 445..455 | CDD:409353 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 496..552 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X32 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||