Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036901.2 | Gene: | Gucy1b1 / 25202 | RGDID: | 2769 | Length: | 619 | Species: | Rattus norvegicus |
Alignment Length: | 300 | Identity: | 61/300 - (20%) |
---|---|---|---|
Similarity: | 107/300 - (35%) | Gaps: | 95/300 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 599 DEYLVV---GNAQLWSVMDIDRAAREIRKEENSLLAAKRLV----DIAQSFAAAESLSVIVVRFR 656
Fly 657 HLGTDVDHLIRELK------QSVRKKPQPVSLPLSSGSVCKRTCCDRSNACRHRAIEQEPLAGR- 714
Fly 715 ----SSPSGQSDRD--LLAKDKDDEFVLAHARVLQEEQQLEMLDETESVSESVLSEEQFKCWEYM 773
Fly 774 LE---------------------QNTQLLFD-------------------KELNTISKSFTKQRT 798
Fly 799 VPNAIMAATVLPERNDFTSNLMRTVTNKFISTSTPQLPQP 838 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
LRR_8 | 109..169 | CDD:290566 | |||
leucine-rich repeat | 111..135 | CDD:275380 | |||
leucine-rich repeat | 136..158 | CDD:275380 | |||
leucine-rich repeat | 159..183 | CDD:275380 | |||
leucine-rich repeat | 184..209 | CDD:275380 | |||
LRR_8 | 205..266 | CDD:290566 | |||
leucine-rich repeat | 210..230 | CDD:275380 | |||
leucine-rich repeat | 232..255 | CDD:275380 | |||
LRR_RI | <256..410 | CDD:238064 | |||
leucine-rich repeat | 256..276 | CDD:275380 | |||
LRR_8 | 279..359 | CDD:290566 | |||
leucine-rich repeat | 280..303 | CDD:275380 | |||
leucine-rich repeat | 304..348 | CDD:275380 | |||
leucine-rich repeat | 349..372 | CDD:275380 | |||
PP2Cc | 461..655 | CDD:294085 | 18/62 (29%) | ||
Gucy1b1 | NP_036901.2 | HNOB | 2..166 | CDD:285002 | |
HNOBA | 207..406 | CDD:285003 | 45/205 (22%) | ||
CYCc | 385..584 | CDD:214485 | 17/114 (15%) | ||
Guanylate_cyc | 412..605 | CDD:278633 | 15/87 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |