| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001276671.1 | Gene: | Lrrc4c / 241568 | MGIID: | 2442636 | Length: | 640 | Species: | Mus musculus |
| Alignment Length: | 321 | Identity: | 81/321 - (25%) |
|---|---|---|---|
| Similarity: | 131/321 - (40%) | Gaps: | 90/321 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 73 LEVCENEMEVLDLSS---LAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVPL 134
Fly 135 KLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNY---RITELVSLDLAYNDLKQ 196
Fly 197 LDQFP----EGFSSIRSLQL---QSNELPSL--------------------PDNFFAVTHARLET 234
Fly 235 LNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLN---DSIFEPLHNAAKLRVLHLAYNRIGVLPAA 296
Fly 297 CVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLC-TPQLAKLAMLKVLDLSH 356 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 7/18 (39%) |
| LRR_8 | 109..169 | CDD:290566 | 10/59 (17%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | 4/23 (17%) | ||
| leucine-rich repeat | 136..158 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 7/26 (27%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 10/28 (36%) | ||
| LRR_8 | 205..266 | CDD:290566 | 19/83 (23%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 7/42 (17%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 4/22 (18%) | ||
| LRR_RI | <256..410 | CDD:238064 | 30/105 (29%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 279..359 | CDD:290566 | 20/79 (25%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | 12/44 (27%) | ||
| leucine-rich repeat | 349..372 | CDD:275380 | 2/8 (25%) | ||
| PP2Cc | 461..655 | CDD:294085 | |||
| Lrrc4c | NP_001276671.1 | LRRNT | 47..80 | CDD:214470 | |
| PPP1R42 | 65..235 | CDD:411060 | 44/179 (25%) | ||
| LRR 1 | 77..98 | 4/16 (25%) | |||
| leucine-rich repeat | 78..101 | CDD:275380 | 5/19 (26%) | ||
| LRR 2 | 101..122 | 7/29 (24%) | |||
| leucine-rich repeat | 102..125 | CDD:275380 | 9/31 (29%) | ||
| LRR 3 | 125..146 | 7/34 (21%) | |||
| leucine-rich repeat | 126..149 | CDD:275380 | 7/36 (19%) | ||
| LRR 4 | 149..170 | 4/21 (19%) | |||
| leucine-rich repeat | 150..173 | CDD:275380 | 6/23 (26%) | ||
| LRR 5 | 173..195 | 7/23 (30%) | |||
| leucine-rich repeat | 174..198 | CDD:275380 | 9/25 (36%) | ||
| LRR 6 | 198..219 | 6/20 (30%) | |||
| leucine-rich repeat | 199..220 | CDD:275380 | 6/20 (30%) | ||
| LRR_8 | 220..279 | CDD:404697 | 12/60 (20%) | ||
| LRR 7 | 220..241 | 2/20 (10%) | |||
| leucine-rich repeat | 221..244 | CDD:275380 | 2/22 (9%) | ||
| LRR 8 | 244..265 | 4/22 (18%) | |||
| leucine-rich repeat | 245..268 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 267..>301 | CDD:404697 | 13/36 (36%) | ||
| LRR 9 | 268..289 | 7/20 (35%) | |||
| leucine-rich repeat | 269..290 | CDD:275380 | 7/20 (35%) | ||
| LRRCT | 301..>339 | CDD:214507 | 15/59 (25%) | ||
| IG | 360..443 | CDD:214652 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 463..482 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X32 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||