DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Gucy1b2

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_011243363.2 Gene:Gucy1b2 / 239134 MGIID:2660873 Length:829 Species:Mus musculus


Alignment Length:178 Identity:37/178 - (20%)
Similarity:67/178 - (37%) Gaps:65/178 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 DNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLA 286
            |.:|::.|.:: |.|:|                              ||.:.:::...|:     
Mouse   420 DEYFSIVHPQV-TFNIS------------------------------SICKFINSQFILK----- 448

  Fly   287 YNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKV 351
             .|..::|.|    |.....|.|.|.|:           .:..|:|.  :.:|:|   ||..|:.
Mouse   449 -TRREMMPEA----WKSQPTLKLRGQMI-----------WMESLKCM--VFMCSP---KLRSLQE 492

  Fly   352 LDLSHNHL------DRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKV 393
            |:.|..||      |....|.|:..:.|..::||  .||:..:::.:|
Mouse   493 LEESKMHLSDIAPHDTTRDLILLNQQRLAEMELS--CQLEKKKEELRV 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566 6/43 (14%)
leucine-rich repeat 210..230 CDD:275380 2/7 (29%)
leucine-rich repeat 232..255 CDD:275380 3/22 (14%)
LRR_RI <256..410 CDD:238064 31/144 (22%)
leucine-rich repeat 256..276 CDD:275380 2/19 (11%)
LRR_8 279..359 CDD:290566 18/79 (23%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 304..348 CDD:275380 10/43 (23%)
leucine-rich repeat 349..372 CDD:275380 8/28 (29%)
PP2Cc 461..655 CDD:294085
Gucy1b2XP_011243363.2 HNOB 115..276 CDD:400167
HNOBA 380..566 CDD:400168 37/178 (21%)
Guanylate_cyc 572..754 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.